DT214489

Overview
NameDT214489
Unique NameDT214489
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length884
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8653 contig Csv1_Contig8653:237..1120. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214489 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 7.817e-98
Identity = 168/182 (92.31%), Postives = 174/182 (95.60%), Query Frame = -1
Query:  117 SLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGIINVPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNFAPTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLS 662
            SL GDNGFDPLGLAEDPENLKW+VQAELVN RWAMLGV GMLLPEVFTKIGIINVP+WYDAGK +YFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLP  EVGYPGGIFNPLNFAPT EAKEKELANGRLAMLAFLGF+VQHNVTGKGPFENLLQH+SDPWHNTIVQT +
Sbjct:   70 SLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPKGEVGYPGGIFNPLNFAPTQEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTFN 251          
BLAST of DT214489 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 3.880e-97
Identity = 168/184 (91.30%), Postives = 174/184 (94.57%), Query Frame = -1
Query:  111 SLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGIINVPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNFAPTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLSGN 662
            SLPGDNGFDPLGLAEDPENL+W+VQAELVN RWAMLGV GMLLPEVFT IGIINVP+WY AGK EYFASSSTLFVIEFIL HYVEIRRWQDIKNPGSVNQDPIFKQYSLP  EVGYPGGIFNPLNFAPT EAKEKE+ANGRLAMLAFLGFI+QHNVTGKGPF+NLLQHISDPWHNTIVQTL GN
Sbjct:   69 SLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTLGGN 252          
BLAST of DT214489 vs. ExPASy Swiss-Prot
Match: CB120_HORVU (Chlorophyll a-b binding protein 1B-20, chloroplastic (Fragment) OS=Hordeum vulgare GN=LHC Ib-20 PE=1 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 1.695e-76
Identity = 140/188 (74.47%), Postives = 158/188 (84.04%), Query Frame = -1
Query:  114 LDGFSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGIINVPQWYDA-GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNFAPTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLSG 674
            LDG SL GDNGFDPL LAEDPE+L+W+VQA++VN RWAMLGV GML+PEV TK G++N P+W    GK  YFASSST   +  +   YVEIRRWQDIKNPGSVNQDPIFK YSLPP+E GYPG +FNPLNFAP  E KEKELANGRLAMLAFLGF+VQHNV GKGPFENL QH++DPWHNTI+QT+SG
Sbjct:   46 LDG-SLEGDNGFDPLALAEDPEDLRWFVQADVVNGRWAMLGVAGMLIPEVLTKAGLMNAPEWLRLPGKETYFASSSTALRVH-MSSTYVEIRRWQDIKNPGSVNQDPIFKSYSLPPHECGYPGRVFNPLNFAPL-ENKEKELANGRLAMLAFLGFLVQHNVHGKGPFENLQQHLADPWHNTIIQTISG 230          
BLAST of DT214489 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 6.266e-55
Identity = 108/192 (56.25%), Postives = 129/192 (67.19%), Query Frame = -1
Query:  117 LDGFSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGIINVPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGI-FNPLNF-----APTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLS 674
            LDG SLPGD GFDPLGL  DPE+LKW  QAELV+SRWAMLG  G+ +PE  TKIG++N P WY AG+ EYF  ++TLFVIE +L  + E RRW DI  PG VN DPIF    L   +VGYPGG+ F+PL +     A   E + KE+ NGRLAMLA +G   QH  TG GP +NL  H++DP H TI    S
Sbjct:   78 LDG-SLPGDFGFDPLGLGSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFTDTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFS 268          
BLAST of DT214489 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.381e-54
Identity = 106/192 (55.21%), Postives = 130/192 (67.71%), Query Frame = -1
Query:  117 LDGFSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGIINVPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGI-FNPLNF-----APTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLS 674
            LDG SLPGD GFDPLGLA DPE+L+W  QAELV+ RWAMLG  G+ +PE+ TKIGI+N P WY AG+ EYF  ++TLF++E +L  + E RRW DI  PG VN DPIF    L   +VGYPGG+ F+PL +     A   E + KE+ NGRLAMLA +G   QH  TG GP +NL  H++DP H TI    S
Sbjct:   78 LDG-SLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFS 268          
BLAST of DT214489 vs. ExPASy Swiss-Prot
Match: CB23_PEA (Chlorophyll a-b binding protein 3, chloroplastic OS=Pisum sativum GN=lhca3 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 4.223e-35
Identity = 98/228 (42.98%), Postives = 130/228 (57.02%), Query Frame = -1
Query:  120 LSFHATKNLTFTKSLDGFSLPGDNGFDPLGLAEDPENL------KWYVQAELVNSRWAMLGVVGMLLPEVFTKIGIINVPQ-----WYD------AGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLP-------PNEVGYPGG-IFNPLNFAPTD----EAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTL 716
            L F + ++L++   LDG SLPGD GFDPLGL+ DPE        +W    E++N R+AMLG VG + PE   K+G+I  PQ     W+       AG   Y+A + TLFV+E  L  + E RR+QD   PGS+      KQY L             YPGG  FNPL F   +    E K KE+ NGRLAMLA LG+ +Q  VTG GP++NLL H++DP +N ++ +L
Sbjct:   57 LWFASKQSLSY---LDG-SLPGDYGFDPLGLS-DPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLI--PQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMG-----KQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNNVLTSL 272          
BLAST of DT214489 vs. ExPASy Swiss-Prot
Match: CB13_SOLLC (Chlorophyll a-b binding protein 8, chloroplastic OS=Solanum lycopersicum GN=CAB8 PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 9.407e-35
Identity = 97/228 (42.54%), Postives = 130/228 (57.02%), Query Frame = -1
Query:  120 LSFHATKNLTFTKSLDGFSLPGDNGFDPLGLAEDPENL------KWYVQAELVNSRWAMLGVVGMLLPEVFTKIGIINVPQ-----WYD------AGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLP-------PNEVGYPGG-IFNPLNFAPTD----EAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTL 716
            L F + ++L++   LDG  LPGD GFDPLGL+ DPE        KW    E++N R+AMLG  G + PE+  K G+I  PQ     W+       AG   Y+A + TLFV+E  L  + E RR+QD   PGS+      KQY L          +  YPGG +FNPL F   +    E K KE+ NGRLAMLA LG+ +Q  VTG GP++NLL H++DP +N ++ +L
Sbjct:   55 LWFASKQSLSY---LDG-RLPGDFGFDPLGLS-DPEGTGGFIEPKWLAYGEVINGRFAMLGAAGAIAPEILGKAGLI--PQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMG-----KQYFLGLEKGLGGSGDPAYPGGPLFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQALVTGVGPYQNLLDHLADPVNNNVLTSL 270          
BLAST of DT214489 vs. ExPASy Swiss-Prot
Match: CB121_HORVU (Chlorophyll a-b binding protein 1B-21, chloroplastic OS=Hordeum vulgare GN=LHC Ib-21 PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 2.030e-29
Identity = 81/194 (41.75%), Postives = 109/194 (56.19%), Query Frame = -1
Query:  132 LDGFSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGIINVPQW--YDAGKAEY------FASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNF----APTDEAKEKELANGRLAMLAFLGFIVQHNV-TGKGPFENLLQHISDPWHNTI 674
            LDG S PGD GFDPLGLA  PEN + + ++E+ + RWAML V G+L+PE       +   +W     G+A Y      + +  T+  IEF+   + E +R        ++ +DP  K+         YPGG F+PL F    A  +E K KE+ NGRLAMLAF+GF VQ +   G GP ENL  H++DPWHN I
Sbjct:   58 LDGSS-PGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQR--------TMEKDPEKKK---------YPGGAFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNI 233          
BLAST of DT214489 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.007e-28
Identity = 79/194 (40.72%), Postives = 108/194 (55.67%), Query Frame = -1
Query:  132 LDGFSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGIINVPQW--YDAGKAEY------FASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNF----APTDEAKEKELANGRLAMLAFLGFIVQHNV-TGKGPFENLLQHISDPWHNTI 674
            LDG S PGD GFD LGL E P NL+ Y ++EL++ RWAML V G+++PE       +   +W     G+A Y      + +  T+  IEF+   +VE +R        S+ +D   K+         YPGG F+PL +    A  +E K KE+ NGRLA+LA +GF VQ +   G GP ENL  H++DPWHN I
Sbjct:   59 LDG-SAPGDFGFDSLGLGEVPANLERYKESELIHCRWAMLAVPGIIVPEALGLGNWVKAQEWAAIPGGQATYLGQPVPWGTLPTILAIEFLAIAFVEHQR--------SMEKDSEKKK---------YPGGAFDPLGYSKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATHLADPWHNNI 234          
BLAST of DT214489 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.153e-24
Identity = 70/195 (35.90%), Postives = 101/195 (51.79%), Query Frame = -1
Query:  114 GDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGIINVPQ--WY-------DAGKAEYFASSSTLFVIEFILFHYVEI--RRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNFAPTDEA----KEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLSG 653
            GD G+DP GL + PEN   Y   EL+++RWAMLG  G ++PE   K G    P+  W+       D     YF  +  + ++  ++   V +    +  I N G   +D +            +PGG F+PL  A   E     K KE+ NGRLAM A LGF +Q  VTG+GP ENL +H+SDP+ N ++  ++G
Sbjct:   91 GDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITN-GLDFEDKL------------HPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLLTVIAG 272          
The following BLAST results are available for this feature:
BLAST of DT214489 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
CB24_ARATH7.817e-9892.31Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB24_PEA3.880e-9791.30Chlorophyll a-b binding protein P4, chloroplastic ... [more]
CB120_HORVU1.695e-7674.47Chlorophyll a-b binding protein 1B-20, chloroplast... [more]
CB12_PETHY6.266e-5556.25Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB12_SOLLC2.381e-5455.21Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB23_PEA4.223e-3542.98Chlorophyll a-b binding protein 3, chloroplastic O... [more]
CB13_SOLLC9.407e-3542.54Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB121_HORVU2.030e-2941.75Chlorophyll a-b binding protein 1B-21, chloroplast... [more]
CB11_SOLLC1.007e-2840.72Chlorophyll a-b binding protein 6A, chloroplastic ... [more]
CB26_ARATH1.153e-2435.90Chlorophyll a-b binding protein CP26, chloroplasti... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Library UCRCS04-2cdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_2_023A07_T72 Ruby Orange Developing Flower cDNA Library UCRCS04-2 Citrus sinensis cDNA clone UCRCS04_023_VN_A07_rd, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214489 ID=DT214489|Name=DT214489|organism=Citrus sinensis|type=EST|length=884bp
ATTGAGGGTTTCCATGTTTACATTGATGCTCAAATCTCACTCAAAAACTA
CAGATTCATGGTTACAAAAGAAAGAAACAGGATCCCGAATTGCCAATCCA
TCTTTGATTAATTACCACTAAGTGTCTGGACGATGGTGTTGTGCCATGGG
TCAGAGATATGTTGCAGGAGGTTTTCAAATGGCCCTTTGCCTGTCACATT
GTGCTGAACAATAAATCCCAAGAATGCCAACATTGCCAATCTCCCATTGG
CAAGCTCCTTCTCCTTTGCCTCATCAGTGGGTGCAAAGTTGAGTGGGTTG
AAGATGCCACCGGGGTACCCAACTTCGTTTGGAGGCAAGCTGTACTGCTT
GAAAATGGGGTCTTGGTTGACACTTCCTGGGTTCTTTATGTCTTGCCATC
TTCTTATCTCCACATAGTGGAACAAGATGAACTCGATCACGAAAAGGGTC
GATGATGATGCAAAGTACTCAGCCTTCCCAGCATCATACCATTGAGGAAC
ATTAATAATTCCAATCTTTGTGAAAACTTCGGGCAACAACATTCCAACAA
CACCCAACATGGCCCAGCGCGAATTCACAAGCTCGGCTTGCACATACCAC
TTCAAGTTCTCAGGATCCTCGGCAAGCCCCAAGGGGTCAAATCCATTGTC
ACCGGGGAGGCTAAAACCATCAAGAGATTTTGTAAATGTTAGATTTTTAG
TAGCATGAAATGATAGCAACACTTTGTTTACAAAATCAGGAGGATATAGA
GAATTTGGTATTAGAAGTAATGTAAAATATGACGTGACATTGTTCTAAAC
TGATCGCATATATGCATGTGACATCAGTTGTTGACATGACTTTGAGGGGG
TTTTGTTTGAGTTAAGTTTTGTACCTGCCGTTGA
back to top