DT214487

Overview
NameDT214487
Unique NameDT214487
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length879
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3368 contig Csv1_Contig3368:31..909. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214487 vs. ExPASy Swiss-Prot
Match: GPAT6_ARATH (Glycerol-3-phosphate acyltransferase 6 OS=Arabidopsis thaliana GN=GPAT6 PE=1 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 1.662e-124
Identity = 216/255 (84.71%), Postives = 237/255 (92.94%), Query Frame = -1
Query:  115 LVQRPTPLVALLTFLWMPIGIILSILRVYTNIPLPERLAWYNYKLLGIKVVVKGTPPPAPKNGQSGVLFICNHRTVLDPVVTAVALGRKISCVTYSISKFTEIISPIKAVALSREREKDAAHIKQLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQTVFHGTTVRGHKLLDPYYVFMNPRPTYEITFLNQLPPELTVKGGKSAIEVANYIQRVLAGTLGFECTNLTRKDKYSILAGTDGRVP 879
            LVQRPTPLVALLTFLW+P+G +LSI+RVYTNIPLPER+A YNYKL GIK+VV G PPP PK GQ G L +CNHRTVLDPVVTAVALGRKISCVTYSISKF+E+ISPIKAVAL+R+REKDAA+IK+LLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQ++F+GTT RG+KLLDPY+ FMNPRPTYEITFL Q+P ELT KGGKS IEVANYIQRVL GTLGFECTN TRKDKY++LAGTDGRVP
Sbjct:  241 LVQRPTPLVALLTFLWLPVGFVLSIIRVYTNIPLPERIARYNYKLTGIKLVVNGHPPPPPKPGQPGHLLVCNHRTVLDPVVTAVALGRKISCVTYSISKFSELISPIKAVALTRQREKDAANIKRLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQSMFNGTTTRGYKLLDPYFAFMNPRPTYEITFLKQIPAELTCKGGKSPIEVANYIQRVLGGTLGFECTNFTRKDKYAMLAGTDGRVP 495          
BLAST of DT214487 vs. ExPASy Swiss-Prot
Match: GPAT4_ARATH (Glycerol-3-phosphate acyltransferase 4 OS=Arabidopsis thaliana GN=GPAT4 PE=1 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 6.580e-97
Identity = 166/257 (64.59%), Postives = 210/257 (81.71%), Query Frame = -1
Query:  112 LVQRPTPLVALLTFLWMPIGIILSILRVYTNIPLPERLAWYNYKLLGIKVVVKGTPPPAPKNGQSGVLFICNHRTVLDPVVTAVALGRKISCVTYSISKFTEIISPIKAVALSREREKDAAHIKQLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQTVFHGTTVRGHKLLDPYYVFMNPRPTYEITFLNQLPPELTVK-GGKSAIEVANYIQRVLAGTLGFECTNLTRKDKYSILAGTDGRVPS 879
            LVQRPTPL AL+ +LW+P G +LS+ RVY N+PLPER   Y Y++LGI + ++G  PP P  G+ G L++ NHRT LDP++ A+ALGRKI+CVTYS+S+ + ++SPI AVAL+R+R  DAA ++QLLE+GDLVICPEGTTCREP+LLRFSALFAEL+DRIVPVA+N KQ +F+GTTVRG K  DPY+ FMNPRP+YE TFL++LP E+TV  GGK+  EVANY+Q+V+ G LGFECT LTRKDKY +L G DG+V S
Sbjct:  239 LVQRPTPLNALIIYLWLPFGFMLSVFRVYFNLPLPERFVRYTYEILGIHLTIRGHRPPPPSPGKPGNLYVLNHRTALDPIIIAIALGRKITCVTYSVSRLSLMLSPIPAVALTRDRVADAARMRQLLEKGDLVICPEGTTCREPYLLRFSALFAELSDRIVPVAMNCKQGMFNGTTVRGVKFWDPYFFFMNPRPSYEATFLDRLPEEMTVNGGGKTPFEVANYVQKVIGGVLGFECTELTRKDKYLLLGGNDGKVES 495          
BLAST of DT214487 vs. ExPASy Swiss-Prot
Match: GPAT8_ARATH (Probable glycerol-3-phosphate acyltransferase 8 OS=Arabidopsis thaliana GN=GPAT8 PE=2 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 9.502e-96
Identity = 165/257 (64.20%), Postives = 209/257 (81.32%), Query Frame = -1
Query:  112 LVQRPTPLVALLTFLWMPIGIILSILRVYTNIPLPERLAWYNYKLLGIKVVVKGTPPPAPKNGQSGVLFICNHRTVLDPVVTAVALGRKISCVTYSISKFTEIISPIKAVALSREREKDAAHIKQLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQTVFHGTTVRGHKLLDPYYVFMNPRPTYEITFLNQLPPELTVK-GGKSAIEVANYIQRVLAGTLGFECTNLTRKDKYSILAGTDGRVPS 879
            L QRPTPL A++T+LW+P G ILSI+RVY N+PLPER   Y Y++LGI + ++G  PP P  G  G L++ NHRT LDP++ A+ALGRKI CVTYS+S+ + ++SPI AVAL+R+R  DAA++++LLE+GDLVICPEGTTCRE +LLRFSALFAEL+DRIVPVA+N KQ +F+GTTVRG K  DPY+ FMNPRP+YE TFL++LP E+TV  GGK+ IEVANY+Q+V+   LGFECT LTRKDKY +L G DG+V S
Sbjct:  238 LAQRPTPLNAIITYLWLPFGFILSIIRVYFNLPLPERFVRYTYEMLGIHLTIRGHRPPPPSPGTLGNLYVLNHRTALDPIIVAIALGRKICCVTYSVSRLSLMLSPIPAVALTRDRATDAANMRKLLEKGDLVICPEGTTCREEYLLRFSALFAELSDRIVPVAMNCKQGMFNGTTVRGVKFWDPYFFFMNPRPSYEATFLDRLPEEMTVNGGGKTPIEVANYVQKVIGAVLGFECTELTRKDKYLLLGGNDGKVES 494          
BLAST of DT214487 vs. ExPASy Swiss-Prot
Match: GPAT5_ARATH (Glycerol-3-phosphate acyltransferase 5 OS=Arabidopsis thaliana GN=GPAT5 PE=1 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 6.596e-89
Identity = 160/254 (62.99%), Postives = 191/254 (75.20%), Query Frame = -1
Query:  118 LVQRPTPLVALLTFLWMPIGIILSILRVYTNIPLPERLAWYNYKLLGIKVVVKGTPPPAPKNGQSGVLFICNHRTVLDPVVTAVALGRKISCVTYSISKFTEIISPIKAVALSREREKDAAHIKQLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQTVFHGTTVRGHKLLDPYYVFMNPRPTYEITFLNQLPPELTVKGGKSAIEVANYIQRVLAGTLGFECTNLTRKDKYSILAGTDGRV 879
            LV+RPTP  AL+  LW+P GIIL+++R++    LP     Y  ++ G  ++VKG PP  P  G+SGVLF+C HRT++DPVV +  LGR I  VTYSIS+ +EI+SPI  V L+R R+ DAA IKQ L +GDLV+CPEGTTCREPFLLRFSALFAELTDRIVPVA+N +   FH TT RG K LDP + FMNPRP YEITFLNQLP E T   GKS  +VANY+QR+LA TLGFECTN TRKDKY +LAG DG V
Sbjct:  228 LVKRPTPATALIILLWIPFGIILAVIRIFLGAVLPLWATPYVSQIFGGHIIVKGKPPQPPAAGKSGVLFVCTHRTLMDPVVLSYVLGRSIPAVTYSISRLSEILSPIPTVRLTRIRDVDAAKIKQQLSKGDLVVCPEGTTCREPFLLRFSALFAELTDRIVPVAMNYRVGFFHATTARGWKGLDPIFFFMNPRPVYEITFLNQLPMEATCSSGKSPHDVANYVQRILAATLGFECTNFTRKDKYRVLAGNDGTV 481          
BLAST of DT214487 vs. ExPASy Swiss-Prot
Match: GPAT7_ARATH (Glycerol-3-phosphate acyltransferase 7 OS=Arabidopsis thaliana GN=GPAT7 PE=1 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.740e-81
Identity = 149/254 (58.66%), Postives = 180/254 (70.87%), Query Frame = -1
Query:  118 LVQRPTPLVALLTFLWMPIGIILSILRVYTNIPLPERLAWYNYKLLGIKVVVKGTPPPAPKNGQSGVLFICNHRTVLDPVVTAVALGRKISCVTYSISKFTEIISPIKAVALSREREKDAAHIKQLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQTVFHGTTVRGHKLLDPYYVFMNPRPTYEITFLNQLPPELTVKGGKSAIEVANYIQRVLAGTLGFECTNLTRKDKYSILAGTDGRV 879
            LV+ PTP  AL+  LW+P GIIL+++R++    LP     Y  ++   + +VKG PP     G  GVLF+C HRT++DPVV +  LGR I  VTYSIS+ +EI+SPI    L+R R+ DA  IK+ L  GDLV+ PEGTTCREPFLLRFSALFAELTD IVPVA+N +   FH TT RG K LDP + FMNPRP YE+TFLNQL  E T   GKS  +VANY+QR+LA TLGFECTN TRKDKY +LAG DG V
Sbjct:  226 LVKLPTPATALIILLWIPFGIILAMIRIFVGFLLPLWAIPYVSRIFNTRFIVKGKPPAQATTGNPGVLFVCTHRTLMDPVVLSYVLGRSIPAVTYSISRLSEILSPIPTFRLTRIRDVDAEMIKKELSNGDLVVYPEGTTCREPFLLRFSALFAELTDNIVPVAMNYRVGFFHATTARGWKGLDPIFFFMNPRPVYEVTFLNQLEVEATCSSGKSPYDVANYVQRILAATLGFECTNFTRKDKYRVLAGNDGTV 479          
BLAST of DT214487 vs. ExPASy Swiss-Prot
Match: GPAT1_ARATH (Glycerol-3-phosphate acyltransferase 1 OS=Arabidopsis thaliana GN=GPAT1 PE=1 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 1.863e-75
Identity = 133/252 (52.78%), Postives = 183/252 (72.62%), Query Frame = -1
Query:  118 PTPLVALLTFLWMPIGIILSILRVYTNIPLPERLAWYNYKLLGIKVVVK--GTPPPAPKNGQSGVLFICNHRTVLDPVVTAVALGRKISCVTYSISKFTEIISPIKAVALSREREKDAAHIKQLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQTVFHGTTVRGHKLLDPYYVFMNPRPTYEITFLNQLPPELTVKGGKSAIEVANYIQRVLAGTLGFECTNLTRKDKYSILAGTDGRV 867
            PTPL  L  F+W+PIG +L++ R+   + LP  +A +   + G+++  K        P+ G SGVL++CNHRT+LDPV    +LG+ ++ VTYS+SKF+E I+P+K V+L R+R+KD   +++LL +GDLV+CPEGTTCREP+LLRFS LFAELT+ IVPVA++ + ++F+GTT  G K LDP +  MNPRP Y +  L +LP E+T  GGKS+ EVAN+IQ  LA  LGFECTNLTR+DKY +LAG +G V
Sbjct:  333 PTPLATLAMFIWLPIGFLLAVFRISVGVFLPYHVANFLASMSGVRITFKTHNLNNGRPEKGNSGVLYVCNHRTLLDPVFLTTSLGKPLTAVTYSLSKFSEFIAPLKTVSLKRDRKKDGEAMQRLLSKGDLVVCPEGTTCREPYLLRFSPLFAELTEDIVPVAVDARVSMFYGTTASGLKCLDPIFFLMNPRPVYCLEILKKLPKEMTCAGGKSSFEVANFIQGELARVLGFECTNLTRRDKYLVLAGNEGIV 584          
BLAST of DT214487 vs. ExPASy Swiss-Prot
Match: GPAT2_ARATH (Probable glycerol-3-phosphate acyltransferase 2 OS=Arabidopsis thaliana GN=GPAT2 PE=2 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 6.021e-58
Identity = 118/263 (44.87%), Postives = 169/263 (64.26%), Query Frame = -1
Query:  118 LVQRPTPLVALLTFLWMPIGIILSILRVYTNIPLPERLA--WYNYKLLGIKVVVKGTPPPAPKNGQSGVLFICNHRTVLDPVVTAVALGRK-ISCVTYSISKFTEIISPIKAVALSREREKDAAHIKQLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQTVFHGTTVRGHKLLDPYYVFMNPRPTYEITFLNQL--PPELTVKG----GKSAIEVANYIQRVLAGTLGFECTNLTRKDKYSILAGTDGRV 879
            L  +PTPL  L+ F+W P   +L+  R+   + LP  LA  +  +  + + + V         + + G LF+CNHRT+LDP+  + AL +K +  VTYS+S+ +E+++PIK V L+R+R KD   +++LL +GDLV+CPEGTTCREP+LLRFS LF+E+ D IVPVAI++  T F+GTT  G K  DP +  +NP P+Y +  L+ +      T +G    GK   EVAN++Q  +   LGFECTNLTR+DKY ILAG +G V
Sbjct:  265 LAVKPTPLNTLVLFMWAPFAAVLAAARLVFGLNLPYSLANPFLAFSGIHLTLTVNNHNDLISADRKRGCLFVCNHRTLLDPLYISYALRKKNMKAVTYSLSRLSELLAPIKTVRLTRDRVKDGQAMEKLLSQGDLVVCPEGTTCREPYLLRFSPLFSEVCDVIVPVAIDSHVTFFYGTTASGLKAFDPIFFLLNPFPSYTVKLLDPVSGSSSSTCRGVPDNGKVNFEVANHVQHEIGNALGFECTNLTRRDKYLILAGNNGVV 527          
BLAST of DT214487 vs. ExPASy Swiss-Prot
Match: GPAT3_ARATH (Probable glycerol-3-phosphate acyltransferase 3 OS=Arabidopsis thaliana GN=GPAT3 PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 2.797e-55
Identity = 118/259 (45.56%), Postives = 161/259 (62.16%), Query Frame = -1
Query:  118 LVQRPTPLVALLTFLWMPIGIILSILRVYTNIPLPERLAWYNYKLLGIKVVVKGTPPPAPKNGQS---GVLFICNHRTVLDPVVTAVALGRK-ISCVTYSISKFTEIISPIKAVALSREREKDAAHIKQLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQTVFHGTTVRGHKLLDPYYVFMNPRPTYEITFLNQLP-PELTVKGGKSAIEVANYIQRVLAGTLGFECTNLTRKDKYSILAGTDGRV 879
            L  +PT +  L+ F+W P     +  R++ ++ +P  L+       G ++ V      + K   S   G LF+CNHRT+LDP+  A AL +K I  VTYS+S+ +EI++PIK V L+R+R  D   +++LL EGDLV+CPEGTTCREP+LLRFS LF E++D IVPVA+    T F+GTT  G K LDP +  ++P PTY I FL+ +         GK   EVAN +Q  +   L FECT+LTRKDKY ILAG +G V
Sbjct:  259 LAIKPTLMNTLVLFMWGPFAAAAAAARLFVSLCIPYSLSIPILAFSGCRLTVTNDYVSSQKQKPSQRKGCLFVCNHRTLLDPLYVAFALRKKNIKTVTYSLSRVSEILAPIKTVRLTRDRVSDGQAMEKLLTEGDLVVCPEGTTCREPYLLRFSPLFTEVSDVIVPVAVTVHVTFFYGTTASGLKALDPLFFLLDPYPTYTIQFLDPVSGATCQDPDGKLKFEVANNVQSDIGKALDFECTSLTRKDKYLILAGNNGVV 517          
The following BLAST results are available for this feature:
BLAST of DT214487 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
GPAT6_ARATH1.662e-12484.71Glycerol-3-phosphate acyltransferase 6 OS=Arabidop... [more]
GPAT4_ARATH6.580e-9764.59Glycerol-3-phosphate acyltransferase 4 OS=Arabidop... [more]
GPAT8_ARATH9.502e-9664.20Probable glycerol-3-phosphate acyltransferase 8 OS... [more]
GPAT5_ARATH6.596e-8962.99Glycerol-3-phosphate acyltransferase 5 OS=Arabidop... [more]
GPAT7_ARATH1.740e-8158.66Glycerol-3-phosphate acyltransferase 7 OS=Arabidop... [more]
GPAT1_ARATH1.863e-7552.78Glycerol-3-phosphate acyltransferase 1 OS=Arabidop... [more]
GPAT2_ARATH6.021e-5844.87Probable glycerol-3-phosphate acyltransferase 2 OS... [more]
GPAT3_ARATH2.797e-5545.56Probable glycerol-3-phosphate acyltransferase 3 OS... [more]
back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Library UCRCS04-2cdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_2_010H03_T72 Ruby Orange Developing Flower cDNA Library UCRCS04-2 Citrus sinensis cDNA clone UCRCS04_010_VN_H03_rd, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214487 ID=DT214487|Name=DT214487|organism=Citrus sinensis|type=EST|length=879bp
GTTTAAACATATGAAAAACAATAGAGCTTAAATTAATCATAAGCTTTTCC
GTTTCAATCTTCCATCTCTTGAATCTTAAGCCTTTTCCTTTTCCTTTTCC
TTTTCCTTCTTCGATGGAACGCGGCCATCAGTACCTGCGAGAATGGAGTA
CTTATCTTTCCTCGTCAAATTGGTGCACTCAAACCCTAATGTACCAGCAA
GCACCCTTTGAATGTAATTAGCAACTTCGATGGCTGATTTGCCGCCTTTC
ACTGTCAGCTCCGGCGGCAGCTGATTCAAGAATGTGATCTCATAAGTTGG
CCTTGGATTCATGAACACATAGTAAGGATCCAACAATTTGTGCCCACGTA
CTGTGGTACCATGAAACACAGTTTGCTTAGTGTTGATAGCAACCGGCACA
ATTCTATCTGTAAGCTCAGCAAAAAGTGCACTGAATCGTAAAAGAAAAGG
CTCCCTGCAGGTTGTTCCCTCGGGGCAGATCACCAAGTCACCTTCTTCAA
GCAATTGCTTGATGTGAGCTGCATCTTTCTCTCTTTCCCTTGACAAGGCA
ACAGCTTTAATGGGTGAAATTATTTCAGTGAACTTGCTAATACTATATGT
GACACAACTAATTTTTCGTCCTAGGGCAACGGCTGTGACCACAGGGTCTA
AAACAGTGCGATGGTTGCATATAAAAAGGACACCACTTTGGCCATTTTTG
GGTGCTGGTGGTGGGGTACCCTTAACGACAACCTTGATGCCCAAAAGCTT
GTAATTGTACCAAGCCAATCGTTCCGGCAAAGGGATGTTTGTATAGACTC
TGAGAATTGATAATATGATACCAATTGGCATCCAAAGGAAGGTCAGAAGA
GCAACAAGTGGAGTTGGTCTTTGAACTAA
back to top