CN189376

Overview
NameCN189376
Unique NameCN189376
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length749
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN189376_ssr627 microsatellite CN189376_ssr627:627..638. BLAST: Citrus ESTs to Prunus persica proteins V1
CN189376_ssr410 microsatellite CN189376_ssr410:410..421. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CN189376 vs. ExPASy Swiss-Prot
Match: HUMS_ARATH (Alpha-humulene/(-)-(E)-beta-caryophyllene synthase OS=Arabidopsis thaliana GN=TPS21 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 7.741e-13
Identity = 37/80 (46.25%), Postives = 55/80 (68.75%), Query Frame = -1
Query:  153 KQHGVSKEEAIKMFEEEVANAWKDINEELMMKPTVVARPLLGTILNLARAIDFIYKEDDGYTHSYLIKDQIASVLGDHVP 392
            +Q GVSKE A+++    V++AWKD+N+ELM +P V   PLL  +LNL+R ID  Y+  D YT+  L+K+ I S+L + +P
Sbjct:  468 QQFGVSKERAVEVMGNIVSDAWKDLNQELM-RPHVFPFPLLMRVLNLSRVIDVFYRYQDAYTNPKLLKEHIVSLLIETIP 546          
BLAST of CN189376 vs. ExPASy Swiss-Prot
Match: DCS3_GOSAR ((+)-delta-cadinene synthase isozyme A OS=Gossypium arboreum GN=CAD1-A PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.460e-11
Identity = 36/80 (45.00%), Postives = 52/80 (65.00%), Query Frame = -1
Query:  156 KQHGVSKEEAIKMFEEEVANAWKDINEELMMKPTVVARPLLGTILNLARAIDFIYKEDDGYTH-SYLIKDQIASVLGDHV 392
            KQ+GV+ +EA   F + + ++WKD+NEE + KPT +  P+L   LNLAR +D +Y+E DGYTH     K  I S+L D +
Sbjct:  475 KQYGVTAQEAYNEFNKHIESSWKDVNEEFL-KPTEMPTPVLCRSLNLARVMDVLYREGDGYTHVGKAAKGGITSLLIDPI 553          
The following BLAST results are available for this feature:
BLAST of CN189376 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
HUMS_ARATH7.741e-1346.25Alpha-humulene/(-)-(E)-beta-caryophyllene synthase... [more]
DCS3_GOSAR1.460e-1145.00(+)-delta-cadinene synthase isozyme A OS=Gossypium... [more]
back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001M03_f Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001M03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN189376 ID=CN189376|Name=CN189376|organism=Citrus sinensis|type=EST|length=749bp
GGGACGGCAGGCCCCCTTNAGGGAAATCTTTAATAACATAAAAATATAAA
ATATTTATTAGTACACACCAATACGATACACCGTATTTCCTTCAAACACA
AACCAAGGAACTGAAAATATTATTAATAGAAGTATAGAACTAGTCGTCAA
AATGGAACGTGGTCTCCTAGCACAGAAGCAATTTGATCTTTAATTAGGTA
AGAATGCGTATAGCCGTCGTCCTCTTTGTAAATAAAATCAATTGCACGAG
CAAGATTAAGAATCGTCCCGAGCAGTGGTCGGGCAACGACGGTTGGCTTC
ATCATCAACTCCTCGTTAATATCTTTCCATGCATTTGCAACTTCTTCTTC
AAACATTTTAATTGCCTCTTCCTTAGAGACACCATGCTGCTTCGTTTTTA
ATCTAAAACATTAATTAATTAACATTACATAATTAACATTAACATGTCCC
AAACTTTCAAAATTTAACAAGCGATGTAAAATGATGTAATCTCAATCATT
CGCGCTCTAGTTGACAGTGTAAAGAAAAAAAAGGAAGGGAAAAAAAAAAA
GGAAATTAAAACACTAACCAATAAACAAAAAACAAATTAACGACCGCTGA
GTAATCATATCATCAATCAATAAGGCGGTGGTGGTGGTCTTGCAGTCGGA
GCCCATATCACATCACTACCACCGGCTCCAGGAGGCAAATGGCAACTATA
CATGGACATCCCACATGAATCTCCTCCTGCCACGTGTCCACTCTCTGTT
back to top