CN189370

Overview
NameCN189370
Unique NameCN189370
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length690
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN189370_ssr274 microsatellite CN189370_ssr274:274..289. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7102 contig Csv1_Contig7102:780..1463. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN189370 vs. ExPASy Swiss-Prot
Match: CHIQ_TOBAC (Acidic endochitinase Q OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 6.510e-16
Identity = 40/109 (36.70%), Postives = 61/109 (55.96%), Query Frame = -1
Query:  364 PEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 690
            P+ +  +AT++F+ AIW WMTP + ++PS+HD  +G W P+  D  + R P +G   NI+ G   CG G  DA+ + + +Y  Y  +L V      P E L C  Q+ F
Sbjct:  148 PDLVATDATISFKTAIWFWMTP-QDNKPSSHDVIIGRWTPSAADQAANRVPGYGVITNIINGGIECGIGRNDAVEDRIGYYRRYCGMLNV-----APGENLDCYNQRNF 250          
BLAST of CN189370 vs. ExPASy Swiss-Prot
Match: CHI9_ORYSJ (Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht9 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.474e-15
Identity = 39/110 (35.45%), Postives = 57/110 (51.82%), Query Frame = -1
Query:  361 PEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFN 690
            PE +  +  ++F+ A+W WMTP +  +PS HD   G W P+  D  + R P +G   NI+ G   CG G  D + N +  Y  Y D+LG+G         L C +Q+ FN
Sbjct:  224 PELVASDPVVSFKTALWFWMTP-QSPKPSCHDVITGQWTPSSGDIAAGRVPGYGVITNIINGGLECGFGPDDRVANRIGFYQRYCDVLGIGY-----GSNLDCYDQRPFN 327          
BLAST of CN189370 vs. ExPASy Swiss-Prot
Match: CHI7_ORYSJ (Chitinase 7 OS=Oryza sativa subsp. japonica GN=Cht7 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.220e-15
Identity = 47/119 (39.50%), Postives = 64/119 (53.78%), Query Frame = -1
Query:  334 PEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFNPNTAPSAAS 690
            PE +  + T+AF+ A+W WMT    SQPS H    G W PT  D+ + R P +G T NIL G   C  G+  A  + V+ Y  Y D+LGVG    GPN  L C  Q  F+ +   ++A+
Sbjct:  228 PELVATDPTVAFKTALWLWMTARSPSQPSPHAVVTGQWTPTPADSAAGRAPGYGLTTNILTGGLQCAGGNGGA--DRVAFYKRYCDVLGVG---YGPN--LDCFGQAPFDGDIMSASAA 339          
BLAST of CN189370 vs. ExPASy Swiss-Prot
Match: CHI2_ORYSJ (Chitinase 2 OS=Oryza sativa subsp. japonica GN=Cht2 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.220e-15
Identity = 41/118 (34.75%), Postives = 62/118 (52.54%), Query Frame = -1
Query:  337 PEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFNPNTAPSAA 690
            P+ +  +AT++F+ A+W WMTP + ++PS+HD   G W P+  D  + R P +G   NI+ G   CG G  D + N +  Y  Y    G+G    G N  L C  Q+ FN  ++   A
Sbjct:  227 PDLVATDATVSFKTALWFWMTP-QGNKPSSHDVITGRWAPSPADAAAGRAPGYGVITNIVNGGLECGHGPDDRVANRIGFYQRYCGAFGIG---TGGN--LDCYNQRPFNSGSSVGLA 338          
BLAST of CN189370 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 4.220e-15
Identity = 36/109 (33.03%), Postives = 59/109 (54.13%), Query Frame = -1
Query:  364 PEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 690
            P+ +  +  ++F++A+W WMTP +  +PS HD  +G W+P+  D  + R P FG   NI+ G   CG+G    + + +  Y  Y  +LGV      P + L C  Q++F
Sbjct:  218 PDLVATDPVISFKSALWFWMTP-QSPKPSCHDVIIGRWQPSAGDRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGV-----SPGDNLDCGNQRSF 320          
BLAST of CN189370 vs. ExPASy Swiss-Prot
Match: CHIC_SOLLC (Basic 30 kDa endochitinase OS=Solanum lycopersicum GN=CHI9 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.511e-15
Identity = 38/109 (34.86%), Postives = 57/109 (52.29%), Query Frame = -1
Query:  364 PEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 690
            P+ +  +  ++F++AIW WMTP +  +PS HD   G W+P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y  +LGV      P E L C  Q++F
Sbjct:  211 PDLVATDPVISFKSAIWFWMTP-QSPKPSCHDVITGRWQPSGADQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGV-----SPGENLDCGNQRSF 313          
BLAST of CN189370 vs. ExPASy Swiss-Prot
Match: CHI7_ORYSI (Chitinase 7 OS=Oryza sativa subsp. indica GN=Cht7 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.511e-15
Identity = 47/119 (39.50%), Postives = 63/119 (52.94%), Query Frame = -1
Query:  334 PEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFNPNTAPSAAS 690
            PE +  + T+AF+ A+W WMT    SQPS H    G W PT  D+ + R P +G T NIL G   C  G+  A  + V+ Y  Y D+LGVG    GPN  L C  Q  F+     ++A+
Sbjct:  228 PELVATDPTVAFKTALWLWMTARSPSQPSPHAVVTGQWTPTPADSAAGRAPGYGLTTNILTGGLQCAGGNGGA--DRVAFYKRYCDVLGVG---YGPN--LDCFGQAPFDGGIMSASAA 339          
BLAST of CN189370 vs. ExPASy Swiss-Prot
Match: CHI3_TOBAC (Endochitinase 3 OS=Nicotiana tabacum GN=CHN14 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.511e-15
Identity = 38/110 (34.55%), Postives = 57/110 (51.82%), Query Frame = -1
Query:  361 PEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFN 690
            P+ +  NA ++F++AIW WMT  +  +PS HD   G W P+  D  + R P +G   NI+ G   CG G    + + +  Y  Y  +LGV      P + + C  QK+FN
Sbjct:  223 PDLVATNAVVSFKSAIWFWMT-AQSPKPSCHDVITGRWTPSAADRAANRLPGYGVITNIINGGLECGHGSDARVQDRIGFYRRYCSILGV-----SPGDNIDCGNQKSFN 326          
BLAST of CN189370 vs. ExPASy Swiss-Prot
Match: CHI2_TOBAC (Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.511e-15
Identity = 36/109 (33.03%), Postives = 59/109 (54.13%), Query Frame = -1
Query:  364 PEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 690
            P+ +  +  ++F++A+W WMTP +  +PS HD  +G W+P+  D  + R P FG   NI+ G   CG+G    + + +  Y  Y  +LGV      P + L C  Q++F
Sbjct:  213 PDLVATDPVISFKSALWFWMTP-QSPKPSCHDVIIGRWQPSSADRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGV-----SPGDNLDCGNQRSF 315          
BLAST of CN189370 vs. ExPASy Swiss-Prot
Match: CHI2_SOLTU (Endochitinase 2 (Fragment) OS=Solanum tuberosum GN=CHTB2 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.511e-15
Identity = 37/109 (33.94%), Postives = 58/109 (53.21%), Query Frame = -1
Query:  364 PEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 690
            P+ +  ++ ++F++AIW WMTP +  +PS HD   G W+P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y  +LGV      P + L C  Q++F
Sbjct:  205 PDLVATDSIISFKSAIWFWMTP-QSPKPSCHDVITGRWQPSGTDQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGV-----SPGDNLDCGNQRSF 307          
The following BLAST results are available for this feature:
BLAST of CN189370 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
CHIQ_TOBAC6.510e-1636.70Acidic endochitinase Q OS=Nicotiana tabacum PE=1 S... [more]
CHI9_ORYSJ2.474e-1535.45Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI7_ORYSJ4.220e-1539.50Chitinase 7 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI2_ORYSJ4.220e-1534.75Chitinase 2 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI1_TOBAC4.220e-1533.03Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]
CHIC_SOLLC5.511e-1534.86Basic 30 kDa endochitinase OS=Solanum lycopersicum... [more]
CHI7_ORYSI5.511e-1539.50Chitinase 7 OS=Oryza sativa subsp. indica GN=Cht7 ... [more]
CHI3_TOBAC5.511e-1534.55Endochitinase 3 OS=Nicotiana tabacum GN=CHN14 PE=3... [more]
CHI2_TOBAC5.511e-1533.03Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1... [more]
CHI2_SOLTU5.511e-1533.94Endochitinase 2 (Fragment) OS=Solanum tuberosum GN... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001L24_f Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001L24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN189370 ID=CN189370|Name=CN189370|organism=Citrus sinensis|type=EST|length=690bp
TTTTTTTTTTTTTAATAAAATATAAGCATATACTTTACAATTCTGCTATT
GAAACACACGAGTGGTTCATGCGGTTCATCATTACATATGTAACCAGATA
TAACGAAGATTTTACAAACCAAATGAATCTCAAATCTACAACGGCAATGA
AGAGGGGCAGACCAATCCACACACTAATTGACCTTGCGCAATATATGAAA
AGATGGAAAAAAAAAAAAAAACTTACAACAAATAGTTTAATTAACCCCAG
TCTTATTGTAATGGTACCCACCTAGAGAGAGAGAGAGAGTCACTCCCACA
ATAATAGCTTGGCTACAATAAACGTCCTCAAGAAGATGCAGCTGAAGGTG
CGGTGTTTGGGTTGAAGGCTTTCTGCTCAGCACAAGAGAGTTCTTCATTA
GGTCCTGCCTGCTCTCGGCCAACACCCAACAGATCAAGGTAATACAAGTA
ATGAGAGACAATGTTGTTCATAGCATCAATATCACCCTGACCGCATACGC
TCTCACCATAGAGGATATTCATTGTGGTACCAAAGTTAGGTCCCCGTTTG
GACAAAGTATCATTCTTGGTGGGCTTCCAGTTGCCAACAAAGGCATCATG
GGCTGAAGGCTGGGATTTCTTGACTGGGGTCATCCACTTCCAAATTGCAG
CCTCAAAGGCAAGGGTAGCATTCTGCTCAATGTATTCGGG
back to top