CN189366

Overview
NameCN189366
Unique NameCN189366
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length685
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2727 contig Csv1_Contig2727:1..685. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN189366 vs. ExPASy Swiss-Prot
Match: EXPA1_ARATH (Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.562e-46
Identity = 82/95 (86.32%), Postives = 89/95 (93.68%), Query Frame = 2
Query:  401 AGGWCNPPQQHFDLSQPVFEQIAQYKAGIVPVSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSN 685
            AGGWCNPPQQHFDLSQPVF++IAQY+AGIVPV+YRRVPC R+GGIRFTINGHSYFNLVLITNVGGAGDV +  +KGSRT WQ MSRNWGQNWQSN
Sbjct:  114 AGGWCNPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAMVKGSRTGWQAMSRNWGQNWQSN 208          
BLAST of CN189366 vs. ExPASy Swiss-Prot
Match: EXP15_ARATH (Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=2 SV=2)

HSP 1 Score: 185.267 bits (469), Expect = 2.664e-46
Identity = 81/95 (85.26%), Postives = 89/95 (93.68%), Query Frame = 2
Query:  401 AGGWCNPPQQHFDLSQPVFEQIAQYKAGIVPVSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSN 685
            AGGWCNPP  HFDLSQPVF++IAQYKAG+VPVSYRRVPC R+GGIRFTINGHSYFNLVL+TNVGGAGDV +V++KGSRT WQ MSRNWGQNWQSN
Sbjct:  117 AGGWCNPPLHHFDLSQPVFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAVKGSRTRWQQMSRNWGQNWQSN 211          
BLAST of CN189366 vs. ExPASy Swiss-Prot
Match: EXP10_ARATH (Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 3.846e-45
Identity = 80/94 (85.11%), Postives = 88/94 (93.62%), Query Frame = 2
Query:  404 GGWCNPPQQHFDLSQPVFEQIAQYKAGIVPVSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSN 685
            GGWCNPP +HFDL+QPVF++IAQY+AGIVPVSYRRVPC R+GGIRFTINGHSYFNLVLITNVGGAGDV + +IKGSRT WQ MSRNWGQNWQSN
Sbjct:  114 GGWCNPPLEHFDLAQPVFQRIAQYRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTVWQAMSRNWGQNWQSN 207          
BLAST of CN189366 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSJ (Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.493e-44
Identity = 76/94 (80.85%), Postives = 87/94 (92.55%), Query Frame = 2
Query:  404 GGWCNPPQQHFDLSQPVFEQIAQYKAGIVPVSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSN 685
            GGWCNPP+ HFD+++P F  IAQY+AGIVPVS+RRVPC +KGG+RFT+NGHSYFNLVL+TNV GAGDVR+VSIKGSRT WQPMSRNWGQNWQSN
Sbjct:  112 GGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQNWQSN 205          
BLAST of CN189366 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSI (Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.493e-44
Identity = 76/94 (80.85%), Postives = 87/94 (92.55%), Query Frame = 2
Query:  404 GGWCNPPQQHFDLSQPVFEQIAQYKAGIVPVSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSN 685
            GGWCNPP+ HFD+++P F  IAQY+AGIVPVS+RRVPC +KGG+RFT+NGHSYFNLVL+TNV GAGDVR+VSIKGSRT WQPMSRNWGQNWQSN
Sbjct:  112 GGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQNWQSN 205          
BLAST of CN189366 vs. ExPASy Swiss-Prot
Match: EXP14_ARATH (Expansin-A14 OS=Arabidopsis thaliana GN=EXPA14 PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.237e-43
Identity = 79/95 (83.16%), Postives = 85/95 (89.47%), Query Frame = 2
Query:  401 AGGWCNPPQQHFDLSQPVFEQIAQYKAGIVPVSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSN 685
            AGGWCNPPQ HFDL+QP+F +IAQYKAG+VPV YRRV C RKGGIRFTINGHSYFNLVLITNV GAGDV +VSIKG+ T WQ MSRNWGQNWQSN
Sbjct:  116 AGGWCNPPQHHFDLAQPIFLRIAQYKAGVVPVQYRRVACRRKGGIRFTINGHSYFNLVLITNVAGAGDVISVSIKGTNTRWQSMSRNWGQNWQSN 210          
BLAST of CN189366 vs. ExPASy Swiss-Prot
Match: EXPA8_ARATH (Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.110e-43
Identity = 80/95 (84.21%), Postives = 87/95 (91.58%), Query Frame = 2
Query:  404 GGWCNPPQQHFDLSQPVFEQIAQYKAGIVPVSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGSRT-DWQPMSRNWGQNWQSN 685
            GGWCNPP QHFDL++P F QIAQY+AGIVPVS+RRVPC +KGGIRFTINGHSYFNLVLI+NVGGAGDV AVSIKGS+T  WQ MSRNWGQNWQSN
Sbjct:  118 GGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSIKGSKTQSWQAMSRNWGQNWQSN 212          
BLAST of CN189366 vs. ExPASy Swiss-Prot
Match: EXPA2_ORYSJ (Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 172.94 bits (437), Expect = 1.368e-42
Identity = 75/94 (79.79%), Postives = 84/94 (89.36%), Query Frame = 2
Query:  404 GGWCNPPQQHFDLSQPVFEQIAQYKAGIVPVSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSN 685
            GGWCNPP+ HFD+++P F QI  Y+AGIVPVSYRRVPC +KGGIRFTINGHSYFNLVL+TNV G GDV++VSIKGS T WQPMSRNWGQNWQSN
Sbjct:  117 GGWCNPPRPHFDMAEPAFLQIGVYRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDVQSVSIKGSSTGWQPMSRNWGQNWQSN 210          
BLAST of CN189366 vs. ExPASy Swiss-Prot
Match: EXPA4_ARATH (Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.512e-41
Identity = 73/94 (77.66%), Postives = 83/94 (88.30%), Query Frame = 2
Query:  404 GGWCNPPQQHFDLSQPVFEQIAQYKAGIVPVSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSN 685
            GGWCNPP++HFDL+ PVF +IAQY+AGIVPVSYRRVPC ++GGIRFTINGH YFNLVLITNV GAGD+   S+KGSRT W  +SRNWGQNWQSN
Sbjct:  121 GGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSRTGWMSLSRNWGQNWQSN 214          
BLAST of CN189366 vs. ExPASy Swiss-Prot
Match: EXPA2_ARATH (Expansin-A2 OS=Arabidopsis thaliana GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 2.580e-41
Identity = 75/95 (78.95%), Postives = 87/95 (91.58%), Query Frame = 2
Query:  404 GGWCNPPQQHFDLSQPVFEQIAQYKAGIVPVSYRRVPCSRKGGIRFTINGHSYFNLVLITNVGGAGDVRAVSIKGSRTD-WQPMSRNWGQNWQSN 685
            GGWCNPP +HFDL++P F QIAQY+AGIVPV++RRVPC + GGIRFTING+ YF+LVLITNVGGAGD+RAVS+KGS+TD WQ MSRNWGQNWQSN
Sbjct:  120 GGWCNPPLKHFDLAEPAFLQIAQYRAGIVPVAFRRVPCEKGGGIRFTINGNPYFDLVLITNVGGAGDIRAVSLKGSKTDQWQSMSRNWGQNWQSN 214          
The following BLAST results are available for this feature:
BLAST of CN189366 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 59
Match NameE-valueIdentityDescription
EXPA1_ARATH1.562e-4686.32Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 ... [more]
EXP15_ARATH2.664e-4685.26Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=... [more]
EXP10_ARATH3.846e-4585.11Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=... [more]
EXPA4_ORYSJ2.493e-4480.85Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA4_ORYSI2.493e-4480.85Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4... [more]
EXP14_ARATH1.237e-4383.16Expansin-A14 OS=Arabidopsis thaliana GN=EXPA14 PE=... [more]
EXPA8_ARATH2.110e-4384.21Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 ... [more]
EXPA2_ORYSJ1.368e-4279.79Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA4_ARATH1.512e-4177.66Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 ... [more]
EXPA2_ARATH2.580e-4178.95Expansin-A2 OS=Arabidopsis thaliana GN=EXPA2 PE=2 ... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001L21_r Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001L21, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN189366 ID=CN189366|Name=CN189366|organism=Citrus sinensis|type=EST|length=685bp
TTTTATTAAGATTTTGGTGACCTGCCATGCAAGCGCACCTGCCATGGCAA
AGGCCGGATGACAAAGAATAATCAGGTCTCAGCCATCTTAATTTCAGGCT
TCTCTGTCCTGACGCATCTCTTACATCCATTATAAAAACCCTCCACAATC
CCGCAATTCACTCCCAATTATGCGGCACAAGCCTACCCGCATGATCAATT
AGCGGCTCAAAATTATTTATCACACATTCAGGCTTTACACCTTAAAGATG
AACAATGAGCTTAGCCTTCACATCAAATCCCAGAACGGTGAACAAACCGT
TCGGTGCCATCAAAACTTGTAAAATATATCGGCCAACCTCCTGTCCGCCT
CCGGTCCAGGTATTCCTTTTTGCCCTCCAAATAATGCTCTCCCAAACAAT
GCCGGTGGCTGGTGCAATCCTCCCCAGCAACATTTTGACCTCTCTCAGCC
TGTGTTTGAACAAATTGCTCAGTACAAAGCTGGGATAGTACCTGTGTCTT
ACAGAAGGGTTCCATGCAGTAGGAAGGGAGGCATCAGATTCACGATCAAC
GGCCATTCTTACTTCAACTTAGTCCTAATCACAAACGTCGGAGGCGCTGG
TGATGTGCGTGCTGTTTCAATCAAAGGGTCAAGAACTGATTGGCAACCCA
TGTCAAGGAACTGGGGTCAAAACTGGCAAAGTAAC
back to top