CN189365

Overview
NameCN189365
Unique NameCN189365
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length632
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN189365 vs. ExPASy Swiss-Prot
Match: EXPA1_ARATH (Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 3.774e-33
Identity = 65/78 (83.33%), Postives = 70/78 (89.74%), Query Frame = -3
Query:  397 LITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSNSYLNGQSLSFKVTTSDGHTVVSNNVAPAGWSFGQTFSGLQV 630
            LITNVGGAGDV +  +KGSRT WQ MSRNWGQNWQSNSYLNGQSLSFKVTTSDG T+VSNNVA AGWSFGQTF+G Q+
Sbjct:  172 LITNVGGAGDVHSAMVKGSRTGWQAMSRNWGQNWQSNSYLNGQSLSFKVTTSDGQTIVSNNVANAGWSFGQTFTGAQL 249          
BLAST of CN189365 vs. ExPASy Swiss-Prot
Match: EXP10_ARATH (Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 9.297e-32
Identity = 64/77 (83.12%), Postives = 69/77 (89.61%), Query Frame = -3
Query:  400 LITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSNSYLNGQSLSFKVTTSDGHTVVSNNVAPAGWSFGQTFSGLQ 630
            LITNVGGAGDV + +IKGSRT WQ MSRNWGQNWQSNSYLNGQ+LSFKVTTSDG TVVS N APAGWS+GQTF+G Q
Sbjct:  171 LITNVGGAGDVHSAAIKGSRTVWQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTVVSFNAAPAGWSYGQTFAGGQ 247          
BLAST of CN189365 vs. ExPASy Swiss-Prot
Match: EXP15_ARATH (Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=2 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 1.586e-31
Identity = 61/77 (79.22%), Postives = 69/77 (89.61%), Query Frame = -3
Query:  400 LITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSNSYLNGQSLSFKVTTSDGHTVVSNNVAPAGWSFGQTFSGLQ 630
            L+TNVGGAGDV +V++KGSRT WQ MSRNWGQNWQSN+ LNGQ+LSFKVT SDG TVVSNN+APA WSFGQTF+G Q
Sbjct:  175 LVTNVGGAGDVHSVAVKGSRTRWQQMSRNWGQNWQSNNLLNGQALSFKVTASDGRTVVSNNIAPASWSFGQTFTGRQ 251          
BLAST of CN189365 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSJ (Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.342e-30
Identity = 61/77 (79.22%), Postives = 67/77 (87.01%), Query Frame = -3
Query:  400 LITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSNSYLNGQSLSFKVTTSDGHTVVSNNVAPAGWSFGQTFSGLQ 630
            L+TNV GAGDVR+VSIKGSRT WQPMSRNWGQNWQSN++L+GQSLSF+VT SDG TV SNNVA  GW FGQTF G Q
Sbjct:  169 LVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQNWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGWQFGQTFEGGQ 245          
BLAST of CN189365 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSI (Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.342e-30
Identity = 61/77 (79.22%), Postives = 67/77 (87.01%), Query Frame = -3
Query:  400 LITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSNSYLNGQSLSFKVTTSDGHTVVSNNVAPAGWSFGQTFSGLQ 630
            L+TNV GAGDVR+VSIKGSRT WQPMSRNWGQNWQSN++L+GQSLSF+VT SDG TV SNNVA  GW FGQTF G Q
Sbjct:  169 LVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQNWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGWQFGQTFEGGQ 245          
BLAST of CN189365 vs. ExPASy Swiss-Prot
Match: EXPA2_ORYSJ (Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 2.991e-30
Identity = 60/77 (77.92%), Postives = 65/77 (84.42%), Query Frame = -3
Query:  400 LITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSNSYLNGQSLSFKVTTSDGHTVVSNNVAPAGWSFGQTFSGLQ 630
            L+TNV G GDV++VSIKGS T WQPMSRNWGQNWQSNSYL+GQSLSF+V  SDG TV SNNV PAGW FGQTF G Q
Sbjct:  174 LVTNVAGPGDVQSVSIKGSSTGWQPMSRNWGQNWQSNSYLDGQSLSFQVAVSDGRTVTSNNVVPAGWQFGQTFEGGQ 250          
BLAST of CN189365 vs. ExPASy Swiss-Prot
Match: EXPA5_ARATH (Expansin-A5 OS=Arabidopsis thaliana GN=EXPA5 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.307e-29
Identity = 61/77 (79.22%), Postives = 67/77 (87.01%), Query Frame = -3
Query:  400 LITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSNSYLNGQSLSFKVTTSDGHTVVSNNVAPAGWSFGQTFSGLQ 630
            L+TNVGGAGDV +VS+KGSRT WQ MSRNWGQNWQSNSYLNGQSLSF VTTSD  +VVS NVAP  WSFGQT++G Q
Sbjct:  176 LVTNVGGAGDVHSVSMKGSRTKWQLMSRNWGQNWQSNSYLNGQSLSFVVTTSDRRSVVSFNVAPPTWSFGQTYTGGQ 252          
BLAST of CN189365 vs. ExPASy Swiss-Prot
Match: EXPA8_ARATH (Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 7.366e-29
Identity = 60/78 (76.92%), Postives = 68/78 (87.18%), Query Frame = -3
Query:  400 LITNVGGAGDVRAVSIKGSRTD-WQPMSRNWGQNWQSNSYLNGQSLSFKVTTSDGHTVVSNNVAPAGWSFGQTFSGLQ 630
            LI+NVGGAGDV AVSIKGS+T  WQ MSRNWGQNWQSNSY+N QSLSF+VTTSDG T+VSN+VAP+ W FGQT+ G Q
Sbjct:  175 LISNVGGAGDVHAVSIKGSKTQSWQAMSRNWGQNWQSNSYMNDQSLSFQVTTSDGRTLVSNDVAPSNWQFGQTYQGGQ 252          
BLAST of CN189365 vs. ExPASy Swiss-Prot
Match: EXPA2_ARATH (Expansin-A2 OS=Arabidopsis thaliana GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 2.143e-28
Identity = 60/78 (76.92%), Postives = 66/78 (84.62%), Query Frame = -3
Query:  400 LITNVGGAGDVRAVSIKGSRTD-WQPMSRNWGQNWQSNSYLNGQSLSFKVTTSDGHTVVSNNVAPAGWSFGQTFSGLQ 630
            LITNVGGAGD+RAVS+KGS+TD WQ MSRNWGQNWQSN+YL GQSLSF+VT SDG TVVS +V P  W FGQTF G Q
Sbjct:  177 LITNVGGAGDIRAVSLKGSKTDQWQSMSRNWGQNWQSNTYLRGQSLSFQVTDSDGRTVVSYDVVPHDWQFGQTFEGGQ 254          
BLAST of CN189365 vs. ExPASy Swiss-Prot
Match: EXP14_ARATH (Expansin-A14 OS=Arabidopsis thaliana GN=EXPA14 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 3.656e-28
Identity = 57/77 (74.03%), Postives = 65/77 (84.42%), Query Frame = -3
Query:  400 LITNVGGAGDVRAVSIKGSRTDWQPMSRNWGQNWQSNSYLNGQSLSFKVTTSDGHTVVSNNVAPAGWSFGQTFSGLQ 630
            LITNV GAGDV +VSIKG+ T WQ MSRNWGQNWQSN+ L+GQ+LSFKVTTSDG TV+SNN  P  WSFGQT++G Q
Sbjct:  174 LITNVAGAGDVISVSIKGTNTRWQSMSRNWGQNWQSNAKLDGQALSFKVTTSDGRTVISNNATPRNWSFGQTYTGKQ 250          
The following BLAST results are available for this feature:
BLAST of CN189365 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
EXPA1_ARATH3.774e-3383.33Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 ... [more]
EXP10_ARATH9.297e-3283.12Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=... [more]
EXP15_ARATH1.586e-3179.22Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=... [more]
EXPA4_ORYSJ1.342e-3079.22Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA4_ORYSI1.342e-3079.22Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4... [more]
EXPA2_ORYSJ2.991e-3077.92Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA5_ARATH3.307e-2979.22Expansin-A5 OS=Arabidopsis thaliana GN=EXPA5 PE=2 ... [more]
EXPA8_ARATH7.366e-2976.92Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 ... [more]
EXPA2_ARATH2.143e-2876.92Expansin-A2 OS=Arabidopsis thaliana GN=EXPA2 PE=2 ... [more]
EXP14_ARATH3.656e-2874.03Expansin-A14 OS=Arabidopsis thaliana GN=EXPA14 PE=... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001L21_f Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001L21, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN189365 ID=CN189365|Name=CN189365|organism=Citrus sinensis|type=EST|length=632bp
TTTTTTTACTGAGAGAACTGATACATAATTTTATTCACCAAAGTCACAAG
ACATAACATTGATCATTAAAAAAAAAAATTAAAGACACATCCAGCAAAAG
GCTAATAATATTATAAGCACAGTTGCTCAGTTTATAGATGGCGGGTGGTA
CATGCCCTCCACTGCCAGCCAATTTCTGTCTCTGCCAATTTCAAAATTAG
AGCAGAGCAGAAACCACCGTACTAGAATACATAATCAAAATATAAAACGC
CAAAGGGCCATTTCAAAATAAGCCCTTTGTCATTTTGATACCAGATTCAA
CTAATTAACGCTATTACACTCATTATTTTATACTTGAAAATGTGAAAAAA
AAAAAAAAAACTGCTGGATTTTGGAGGCTGAGTTTCAACTTCAGGGAACT
TGCAGGCCACTGAAGGTTTGGCCAAAGGACCAGCCAGCTGGGGCAACATT
GTTAGAGACAACAGTGTGGCCATCACTTGTGGTGACCTTAAATGAGAGGC
TTTGGCCATTGAGGTAACTGTTACTTTGCCAGTTTTGACCCCAGTTCCTT
GACATGGGTTGCCAATCAGTTCTTGACCCTTTGATTGAAACAGCACGCAC
ATCACCAGCGCCTCCGACGTTTGTGATTAGGA
back to top