CN189362

Overview
NameCN189362
Unique NameCN189362
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length627
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10454 contig Csv1_Contig10454:28..654. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN189362 vs. ExPASy Swiss-Prot
Match: EXPA1_ARATH (Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 2.919e-78
Identity = 135/180 (75.00%), Postives = 145/180 (80.56%), Query Frame = 1
Query:   94 HANG--GGGWINARATFYXXXXXXXXXXXXXXYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKCVNDPKWCLPGTIMVTATNFCXXXXXXXXXXGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYKRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPM 627
            H NG  GGGW+NA ATFY              YGNLYSQGYGTNTAALSTALFNNGLSCG+C+EI+C ND KWCLPG+I+VTATNFC          GGWCNPPQQHFDLSQPVFQ IAQYRAG+VPVAY+RVPC RRGGIRFTINGHSYFNLVLITNVGGAGDVH+  +KGSRTGWQ M
Sbjct:   18 HVNGYAGGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIRCQNDGKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAMVKGSRTGWQAM 197          
BLAST of CN189362 vs. ExPASy Swiss-Prot
Match: EXP10_ARATH (Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=2 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 6.730e-75
Identity = 129/174 (74.14%), Postives = 141/174 (81.03%), Query Frame = 1
Query:  106 GGGWINARATFYXXXXXXXXXXXXXXYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKCVNDPKWCLPGTIMVTATNFCXXXXXXXXXXGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYKRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPM 627
            GGGWINA ATFY              YGNLYSQGYGT+TAALSTALFNNGLSCGSC+EI+C ND KWCLPG+I+VTATNFC          GGWCNPP +HFDL+QPVFQ IAQYRAG+VPV+Y+RVPC RRGGIRFTINGHSYFNLVLITNVGGAGDVH+ +IKGSRT WQ M
Sbjct:   23 GGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGSCFEIRCENDGKWCLPGSIVVTATNFCPPNNALANNNGGWCNPPLEHFDLAQPVFQRIAQYRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTVWQAM 196          
BLAST of CN189362 vs. ExPASy Swiss-Prot
Match: EXP15_ARATH (Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=2 SV=2)

HSP 1 Score: 272.707 bits (696), Expect = 1.074e-72
Identity = 125/172 (72.67%), Postives = 137/172 (79.65%), Query Frame = 1
Query:  112 GWINARATFYXXXXXXXXXXXXXXYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKCVNDPKWCLPGTIMVTATNFCXXXXXXXXXXGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYKRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPM 627
            GW+NA ATFY              YGNLYSQGYGTNTAALSTALFNNGLSCG+C+EIKC +D  WCLPG I+VTATNFC          GGWCNPP  HFDLSQPVFQ IAQY+AGVVPV+Y+RVPC RRGGIRFTINGHSYFNLVL+TNVGGAGDVH+V++KGSRT WQ M
Sbjct:   29 GWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIKCQSDGAWCLPGAIIVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAVKGSRTRWQQM 200          
BLAST of CN189362 vs. ExPASy Swiss-Prot
Match: EXP14_ARATH (Expansin-A14 OS=Arabidopsis thaliana GN=EXPA14 PE=2 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 2.097e-68
Identity = 119/172 (69.19%), Postives = 132/172 (76.74%), Query Frame = 1
Query:  112 GWINARATFYXXXXXXXXXXXXXXYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKCVNDPKWCLPGTIMVTATNFCXXXXXXXXXXGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYKRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPM 627
            GW+NARATFY              YGNLYSQGYGTNTAALSTALFN G SCG+C++IKCV+DPKWC+ GTI VT TNFC          GGWCNPPQ HFDL+QP+F  IAQY+AGVVPV Y+RV C R+GGIRFTINGHSYFNLVLITNV GAGDV +VSIKG+ T WQ M
Sbjct:   28 GWVNARATFYGGADASGTMGGACGYGNLYSQGYGTNTAALSTALFNGGQSCGACFQIKCVDDPKWCIGGTITVTGTNFCPPNFAQANNAGGWCNPPQHHFDLAQPIFLRIAQYKAGVVPVQYRRVACRRKGGIRFTINGHSYFNLVLITNVAGAGDVISVSIKGTNTRWQSM 199          
BLAST of CN189362 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSJ (Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 7.968e-68
Identity = 116/177 (65.54%), Postives = 136/177 (76.84%), Query Frame = 1
Query:   97 ANGGGGWINARATFYXXXXXXXXXXXXXXYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKCVNDPKWCLPGTIMVTATNFCXXXXXXXXXXGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYKRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPM 627
            A G GGW +A ATFY              YGNLYSQGYGTNTAALSTALFN+G +CGSCYE++C N    CLPG+I VTATNFC          GGWCNPP+ HFD+++P F HIAQYRAG+VPV+++RVPC ++GG+RFT+NGHSYFNLVL+TNV GAGDV +VSIKGSRTGWQPM
Sbjct:   18 AAGYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGAACGSCYELRCDNAGSSCLPGSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPM 194          
BLAST of CN189362 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSI (Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 7.968e-68
Identity = 116/177 (65.54%), Postives = 136/177 (76.84%), Query Frame = 1
Query:   97 ANGGGGWINARATFYXXXXXXXXXXXXXXYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKCVNDPKWCLPGTIMVTATNFCXXXXXXXXXXGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYKRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPM 627
            A G GGW +A ATFY              YGNLYSQGYGTNTAALSTALFN+G +CGSCYE++C N    CLPG+I VTATNFC          GGWCNPP+ HFD+++P F HIAQYRAG+VPV+++RVPC ++GG+RFT+NGHSYFNLVL+TNV GAGDV +VSIKGSRTGWQPM
Sbjct:   18 AAGYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGAACGSCYELRCDNAGSSCLPGSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPM 194          
BLAST of CN189362 vs. ExPASy Swiss-Prot
Match: EXPA8_ARATH (Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 2.318e-67
Identity = 118/174 (67.82%), Postives = 133/174 (76.44%), Query Frame = 1
Query:  109 GGWINARATFYXXXXXXXXXXXXXXYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKCVNDPKWCLPGTIMVTATNFCXXXXXXXXXXGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYKRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRT-GWQPM 627
            GGW    ATFY              YGNLY QGYGTNTAALSTALFNNGL+CG+CYE+KC +DP+WCL  TI VTATNFC          GGWCNPP QHFDL++P F  IAQYRAG+VPV+++RVPC ++GGIRFTINGHSYFNLVLI+NVGGAGDVHAVSIKGS+T  WQ M
Sbjct:   28 GGWQGGHATFYGGEDASGTMGGACGYGNLYGQGYGTNTAALSTALFNNGLTCGACYEMKCNDDPRWCLGSTITVTATNFCPPNPGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSIKGSKTQSWQAM 201          
BLAST of CN189362 vs. ExPASy Swiss-Prot
Match: EXPA4_ARATH (Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 5.165e-67
Identity = 115/176 (65.34%), Postives = 133/176 (75.57%), Query Frame = 1
Query:  106 GGGWINARATFYXXXXXXXXXXXXXXYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKCVNDPKWCLPGT--IMVTATNFCXXXXXXXXXXGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYKRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPM 627
            GG W NA ATFY              YGNLYSQGYGTNTAALSTALFNNG+SCG+C+E+KC NDP+WC  G+  I++TATNFC          GGWCNPP++HFDL+ PVF  IAQYRAG+VPV+Y+RVPC +RGGIRFTINGH YFNLVLITNV GAGD+   S+KGSRTGW  +
Sbjct:   28 GGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSRTGWMSL 203          
BLAST of CN189362 vs. ExPASy Swiss-Prot
Match: EXPA9_ARATH (Expansin-A9 OS=Arabidopsis thaliana GN=EXPA9 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.272e-65
Identity = 112/173 (64.74%), Postives = 132/173 (76.30%), Query Frame = 1
Query:  106 GGGWINARATFYXXXXXXXXXXXXXXYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKCVNDPKWCLPG--TIMVTATNFCXXXXXXXXXXGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYKRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGW 618
            GG WINA ATFY              YGNLYSQGYG NTAALSTALFNNGLSCGSC+E+KC+NDP WCLPG  +I++TATNFC          GGWCNPP++HFDL+ P+F  IA+Y+AG+VPV+Y+R+PC ++GGIRFTING  YFNLVL+TNV GAGDV  VS+KGS T W
Sbjct:   29 GGPWINAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFNQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKYFNLVLVTNVAGAGDVIKVSVKGSNTQW 201          
BLAST of CN189362 vs. ExPASy Swiss-Prot
Match: EXPA2_ORYSJ (Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 245.358 bits (625), Expect = 1.837e-64
Identity = 109/173 (63.01%), Postives = 128/173 (73.99%), Query Frame = 1
Query:  109 GGWINARATFYXXXXXXXXXXXXXXYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKCVNDPKWCLPGTIMVTATNFCXXXXXXXXXXGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYKRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPM 627
            G W +A ATFY              YGNLYS GYGTNTAALST LFN+G +CGSCYE++C ND +WCLPG++ VTATN C          GGWCNPP+ HFD+++P F  I  YRAG+VPV+Y+RVPC ++GGIRFTINGHSYFNLVL+TNV G GDV +VSIKGS TGWQPM
Sbjct:   27 GSWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTVLFNDGAACGSCYELRCDNDGQWCLPGSVTVTATNLCPPNYALPNDDGGWCNPPRPHFDMAEPAFLQIGVYRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDVQSVSIKGSSTGWQPM 199          
The following BLAST results are available for this feature:
BLAST of CN189362 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 65
Match NameE-valueIdentityDescription
EXPA1_ARATH2.919e-7875.00Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 ... [more]
EXP10_ARATH6.730e-7574.14Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=... [more]
EXP15_ARATH1.074e-7272.67Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=... [more]
EXP14_ARATH2.097e-6869.19Expansin-A14 OS=Arabidopsis thaliana GN=EXPA14 PE=... [more]
EXPA4_ORYSJ7.968e-6865.54Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA4_ORYSI7.968e-6865.54Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4... [more]
EXPA8_ARATH2.318e-6767.82Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 ... [more]
EXPA4_ARATH5.165e-6765.34Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 ... [more]
EXPA9_ARATH1.272e-6564.74Expansin-A9 OS=Arabidopsis thaliana GN=EXPA9 PE=2 ... [more]
EXPA2_ORYSJ1.837e-6463.01Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXP... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001L19_r Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001L19, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN189362 ID=CN189362|Name=CN189362|organism=Citrus sinensis|type=EST|length=627bp
AGGTTACTCTGCTTCTGGGCTTCCAATTTCTCCAAGAAAATGTATTTTGC
TGGGTTTTTCTCGTTGGGTTTCCTTGCATTGGTGTCCTCCGTTCATGCTA
ATGGAGGCGGTGGGTGGATCAATGCTCGTGCCACTTTCTATGGTGGTGGC
GATGCTTCAGGGACTATGGGTGGGGCTTGTGGCTATGGGAATCTGTATAG
CCAGGGTTATGGAACGAACACTGCAGCCTTGAGCACGGCTTTGTTCAACA
ACGGTTTGAGCTGTGGGTCTTGCTATGAGATTAAGTGTGTTAATGACCCC
AAATGGTGCTTGCCCGGCACCATTATGGTCACAGCTACCAATTTTTGCCC
ACCGAACAACGCCCTCCCCAACAATGCAGGCGGTTGGTGCAATCCTCCGC
AGCAACATTTTGATCTCTCTCAGCCTGTGTTCCAACACATTGCTCAATAC
AGAGCTGGAGTTGTCCCTGTAGCTTACAAGAGGGTACCCTGCGGAAGAAG
GGGAGGCATCAGGTTCACAATCAATGGCCATTCCTACTTCAACCTAGTGT
TGATCACCAACGTTGGTGGTGCTGGTGATGTTCATGCTGTTTCAATCAAA
GGGTCTAGAACTGGCTGGCAGCCCATG
back to top