CX286804

Overview
NameCX286804
Unique NameCX286804
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length542
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX286804 vs. ExPASy Swiss-Prot
Match: P2SAF_ARATH (Photosystem II stability/assembly factor HCF136, chloroplastic OS=Arabidopsis thaliana GN=HCF136 PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 7.369e-47
Identity = 86/101 (85.15%), Postives = 99/101 (98.02%), Query Frame = 2
Query:    2 WLLVRGGGLFLSKGTGITEEFEEVPVQSRGFGILDVGYRSQDEAWAAGGSGVLLKTTNGGKTWIREKAADNIAANLYSVKFINEKKGFVLGNDGVLLQYLG 304
            WLLVRGGGL+LSKGTGITEEFEEVPVQSRGFGILDVGYRS++EAWAAGGSG+LL+T NGGK+W R+KAADNIAANLY+VKF+++KKGFVLGNDGVLL+Y+G
Sbjct:  303 WLLVRGGGLYLSKGTGITEEFEEVPVQSRGFGILDVGYRSEEEAWAAGGSGILLRTRNGGKSWNRDKAADNIAANLYAVKFVDDKKGFVLGNDGVLLRYVG 403          
BLAST of CX286804 vs. ExPASy Swiss-Prot
Match: P2SAF_ORYSJ (Photosystem II stability/assembly factor HCF136, chloroplastic OS=Oryza sativa subsp. japonica GN=HCF136 PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 4.943e-43
Identity = 87/123 (70.73%), Postives = 97/123 (78.86%), Query Frame = 2
Query:    2 WLLVRGGGLFLSKGTG----------------------ITEEFEEVPVQSRGFGILDVGYRSQDEAWAAGGSGVLLKTTNGGKTWIREKAADNIAANLYSVKFINEKKGFVLGNDGVLLQYLG 304
            WLLVRGGGLFLSKG+G                      ITE+FEE  VQSRGFGILDVGYRS+DEAWAAGGSGVLLKTTNGGKTW+R+KAADNIAANLYSVKF+ + KG+VLGNDGVLL+Y+G
Sbjct:  294 WLLVRGGGLFLSKGSGFQFFYRGLNDAHAISYLHPPNQITEDFEEASVQSRGFGILDVGYRSKDEAWAAGGSGVLLKTTNGGKTWVRDKAADNIAANLYSVKFLGDNKGYVLGNDGVLLRYVG 416          
BLAST of CX286804 vs. ExPASy Swiss-Prot
Match: YC48L_SYNY3 (Ycf48-like protein OS=Synechocystis sp. (strain PCC 6803) GN=slr2034 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.234e-19
Identity = 45/100 (45.00%), Postives = 66/100 (66.00%), Query Frame = 2
Query:    2 WLLVRGGGLFLSKGTGITEEFEEVPVQSRG-FGILDVGYRSQDEAWAAGGSGVLLKTTNGGKTWIREKAADNIAANLYSVKFINEKKGFVLGNDGVLLQY 298
            WLL RGG L  S      E  + +  Q +G +G+LD+ +R+ +E W AG SG LL + +GG+TW ++   ++I ANLY V F++ +KGFVLG DG+LL+Y
Sbjct:  233 WLLARGGQLQFSTDPDAEEWSDVIAPQDKGSWGLLDLSFRTPEEVWVAGASGNLLMSQDGGQTWAKDTGVEDIPANLYRVVFLSPEKGFVLGQDGILLKY 332          
BLAST of CX286804 vs. ExPASy Swiss-Prot
Match: YC48L_ANAVT (Ycf48-like protein OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=Ava_1856 PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.891e-18
Identity = 44/100 (44.00%), Postives = 65/100 (65.00%), Query Frame = 2
Query:    2 WLLVRGGGLFLSKGTGITEEFE-EVPVQSRGFGILDVGYRSQDEAWAAGGSGVLLKTTNGGKTWIREKAADNIAANLYSVKFINEKKGFVLGNDGVLLQY 298
            WLL RGG +  S  T   E  + + P  +  +G+LD+ YR+ +E W  GGSG LL +T+GGKTW +++  + +AAN Y V F+   +GFV+G+ GVLL+Y
Sbjct:  226 WLLARGGQVQFSDPTKPDEWLDAQTPELATSWGLLDMAYRTPNEVWIGGGSGNLLVSTDGGKTWEKDRDVEEVAANFYKVVFLKPDQGFVIGDRGVLLKY 325          
BLAST of CX286804 vs. ExPASy Swiss-Prot
Match: YC48L_ANASP (Ycf48-like protein OS=Anabaena sp. (strain PCC 7120) GN=alr3844 PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.891e-18
Identity = 44/100 (44.00%), Postives = 64/100 (64.00%), Query Frame = 2
Query:    2 WLLVRGGGLFLSKGTGITEEFE-EVPVQSRGFGILDVGYRSQDEAWAAGGSGVLLKTTNGGKTWIREKAADNIAANLYSVKFINEKKGFVLGNDGVLLQY 298
            WLL RGG +  S      E  + E P  +  +G+LD+ YR+ +E W  GGSG LL +T+GGKTW +++  + +AAN Y V F+   +GFV+G+ GVLL+Y
Sbjct:  226 WLLARGGQVQFSDPANPDEWLDAETPELATSWGLLDMAYRTPNEVWIGGGSGNLLVSTDGGKTWEKDRDVEEVAANFYKVVFLKPDQGFVIGDRGVLLKY 325          
BLAST of CX286804 vs. ExPASy Swiss-Prot
Match: YC48L_SYNP6 (Ycf48-like protein OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=syc0372_d PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 7.187e-18
Identity = 46/111 (41.44%), Postives = 69/111 (62.16%), Query Frame = 2
Query:    2 WLLVRGGGLFLSKGTGITEEFEEV------------PVQSRGFGILDVGYRSQDEAWAAGGSGVLLKTTNGGKTWIREKAADNIAANLYSVKFINEKKGFVLGNDGVLLQY 298
            WL+ RGG L  SK + I + +EE+            P ++ G+G LD+ YRS+ E W +GGSG LL + +GG+ W R++    + +NLY++KF   K+GFVLG  G+LL+Y
Sbjct:  234 WLIARGGRLQFSKTSQI-DNWEEMLEESDAWGTAIEPERNAGWGFLDLAYRSKQEIWLSGGSGTLLVSEDGGEHWQRDRVIAKLPSNLYTIKFFAPKQGFVLGQRGLLLRY 343          
BLAST of CX286804 vs. ExPASy Swiss-Prot
Match: YC48L_SYNE7 (Ycf48-like protein OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_1178 PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 7.187e-18
Identity = 46/111 (41.44%), Postives = 69/111 (62.16%), Query Frame = 2
Query:    2 WLLVRGGGLFLSKGTGITEEFEEV------------PVQSRGFGILDVGYRSQDEAWAAGGSGVLLKTTNGGKTWIREKAADNIAANLYSVKFINEKKGFVLGNDGVLLQY 298
            WL+ RGG L  SK + I + +EE+            P ++ G+G LD+ YRS+ E W +GGSG LL + +GG+ W R++    + +NLY++KF   K+GFVLG  G+LL+Y
Sbjct:  234 WLIARGGRLQFSKTSQI-DNWEEMLEESDAWGTAIEPERNAGWGFLDLAYRSKQEIWLSGGSGTLLVSEDGGEHWQRDRVIAKLPSNLYTIKFFAPKQGFVLGQRGLLLRY 343          
BLAST of CX286804 vs. ExPASy Swiss-Prot
Match: P2SAF_CYAPA (Photosystem II stability/assembly factor HCF136 OS=Cyanophora paradoxa GN=hcf136 PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 7.187e-18
Identity = 42/105 (40.00%), Postives = 63/105 (60.00%), Query Frame = 2
Query:    2 WLLVRGGGLFLSKGTGITEEFEEVPVQSRG-----FGILDVGYRSQDEAWAAGGSGVLLKTTNGGKTWIREKAADNIAANLYSVKFINEKKGFVLGNDGVLLQYL 301
            W+L RGG L+ S      E   E P    G      G+L++ +++  E W +GGSG+LL + + G TW +E + DNI +N Y + FI+++ GFVLGN G LL+Y+
Sbjct:  227 WMLTRGGQLWFSSNDSFDEPNWEGPKTPEGKVGFGLGLLNLAFKTPTEIWVSGGSGILLSSQDTGNTWKKETSTDNIPSNFYKISFIDKEVGFVLGNQGTLLRYV 331          
BLAST of CX286804 vs. ExPASy Swiss-Prot
Match: YC48L_SYNP2 (Ycf48-like protein OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=SYNPCC7002_A0229 PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.601e-17
Identity = 45/103 (43.69%), Postives = 60/103 (58.25%), Query Frame = 2
Query:    2 WLLVRGGGLFLSKGTGI--TEEFEE--VPVQSRGFGILDVGYRSQDEAWAAGGSGVLLKTTNGGKTWIREKAADNIAANLYSVKFINEKKGFVLGNDGVLLQY 298
            WLL RGG +  S  T     E + E   P      G+L +GYR+  E WA GGSG ++ + +GG TW R+ A + I  N Y V F+NE KGF+LG  GV+L+Y
Sbjct:  231 WLLARGGVVQFSDDTNPDNAEAWSEPVTPQYRNSVGLLHIGYRTPAELWAVGGSGSVVVSKDGGDTWFRDAALEEIPTNFYRVVFLNENKGFILGQQGVILRY 333          
BLAST of CX286804 vs. ExPASy Swiss-Prot
Match: P2SAF_GUITH (Photosystem II stability/assembly factor HCF136, chloroplastic OS=Guillardia theta GN=hcf136 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 6.084e-17
Identity = 38/104 (36.54%), Postives = 62/104 (59.62%), Query Frame = 2
Query:    2 WLLVRGGGLFLSKGTGITEE-----FEEVPVQSRGFGILDVGYRSQDEAWAAGGSGVLLKTTNGGKTWIREKAADNIAANLYSVKFINEKKGFVLGNDGVLLQY 298
            W+  RGGGL +S      E      FE + +++ G+GILD  + +  + W   G G++  +T+ GK W +    D ++ NLY +KF+N  KGF+LG++G+LL+Y
Sbjct:  291 WMSTRGGGLSVSTKNFDFESISSFNFENIDIKTGGYGILDAAFVNDKDIWIICGGGIVYNSTDKGKNWTKVDGIDKLSGNLYKIKFVNNNKGFILGSNGLLLRY 394          
The following BLAST results are available for this feature:
BLAST of CX286804 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
P2SAF_ARATH7.369e-4785.15Photosystem II stability/assembly factor HCF136, c... [more]
P2SAF_ORYSJ4.943e-4370.73Photosystem II stability/assembly factor HCF136, c... [more]
YC48L_SYNY32.234e-1945.00Ycf48-like protein OS=Synechocystis sp. (strain PC... [more]
YC48L_ANAVT1.891e-1844.00Ycf48-like protein OS=Anabaena variabilis (strain ... [more]
YC48L_ANASP1.891e-1844.00Ycf48-like protein OS=Anabaena sp. (strain PCC 712... [more]
YC48L_SYNP67.187e-1841.44Ycf48-like protein OS=Synechococcus sp. (strain AT... [more]
YC48L_SYNE77.187e-1841.44Ycf48-like protein OS=Synechococcus elongatus (str... [more]
P2SAF_CYAPA7.187e-1840.00Photosystem II stability/assembly factor HCF136 OS... [more]
YC48L_SYNP21.601e-1743.69Ycf48-like protein OS=Synechococcus sp. (strain AT... [more]
P2SAF_GUITH6.084e-1736.54Photosystem II stability/assembly factor HCF136, c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01001C02Rv Veg1 Citrus clementina cDNA clone C01001C02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX286804 ID=CX286804|Name=CX286804|organism=Citrus clementina|type=EST|length=542bp
TTGGCTTCTTGTTCGGGGAGGGGGACTTTTTCTCAGCAAGGGCACAGGGA
TTACAGAGGAGTTTGAAGAAGTTCCGGTACAAAGTCGGGGTTTTGGTATT
CTTGATGTTGGATACCGTTCACAGGATGAGGCTTGGGCAGCAGGTGGCAG
TGGAGTTCTCTTAAAAACCACCAATGGTGGTAAGACATGGATCCGAGAGA
AAGCAGCAGACAACATTGCCGCAAACCTTTACTCGGTGAAGTTCATCAAT
GAAAAGAAGGGGTTCGTATTGGGGAACGATGGAGTCTTGCTTCAATATCT
AGGATAGATTGAAATTTGTACATACGGTATTTATATCTTCATGTGGTAAA
GAGGGACCAAAATGCCGTTGATATGATATTTGTACCGGGCTTGTAACTAC
TAAATTTATATTTACTTATTCGTGACTATAAGCATTTTGTTTCAACGGGG
ACGTTGATCATTTGCAAAAGTTTGCAACTAGACACAACAGTTCATGTTCG
GTGATCGAAGTAAAATATTGTGCAAATATAGAAATGAAATTA
back to top