CX286936

Overview
NameCX286936
Unique NameCX286936
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length624
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX286936 vs. ExPASy Swiss-Prot
Match: MA1C1_HUMAN (Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens GN=MAN1C1 PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.147e-43
Identity = 93/201 (46.27%), Postives = 122/201 (60.70%), Query Frame = 1
Query:   37 TPSSFTYICEKNGDSLIDKMDELACFAPGMIALGSSGYGPGDSEKFLSLAEELAWTCYNFYQSTPTKLAGENYFFRDGQDM---SVGTSWNILRPETVESLFYLWRLTGNKTYKEWGWNIFQAFEKNSRIESGYVGLKDV--NTGDKDNMMQSFFLAETLKYLXLLFSPTTVISLDEWVFNTEAHPLKIVTQRDGEISGRS 624
            +P   TYI E  G  L  KM  LACF+ GMIALG+          +  LA ++  TC+  Y  + TKL  E ++F  G++     +  S+ ILRPE VES  YLWR T N  Y+EWGW +  A EK  R E+G+ G++DV  +T + DN  QSFFLAETLKYL LLFS   ++SL++WVFNTEAHPL +      + SGR+
Sbjct:  429 SPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGAEDAKEEKRAHYRELAAQITKTCHESYARSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESYMYLWRQTHNPIYREWGWEVVLALEKYCRTEAGFSGIQDVYSSTPNHDNKQQSFFLAETLKYLYLLFSEDDLLSLEDWVFNTEAHPLPV---NHSDSSGRA 626          
BLAST of CX286936 vs. ExPASy Swiss-Prot
Match: MA122_DROME (Mannosyl-oligosaccharide alpha-1,2-mannosidase isoform B OS=Drosophila melanogaster GN=alpha-Man-I PE=2 SV=2)

HSP 1 Score: 167.548 bits (423), Expect = 4.818e-41
Identity = 88/197 (44.67%), Postives = 123/197 (62.44%), Query Frame = 1
Query:   13 LLSLVRRSTPSSFTYICEKNGDSLIDKMDELACFAPGMIALGSSGYGPGDSEKFLSLAEELAWTCYNFYQSTPTKLAGENYFFRDGQDMSVGTS---WNILRPETVESLFYLWRLTGNKTYKEWGWNIFQAFEKNSRIESGYVGLKDVNTGD--KDNMMQSFFLAETLKYLXLLFSPTTVISLDEWVFNTEAHPLKI 588
            +L  + R++P   TY+ +   D L  KMD LACF+ G+ ALG++      ++K++ + + +  TC+  Y   PT+L  E + F +  +     S   + ILRPET ES F LWRLT ++ Y++WGW    A EK+ R   GY GL++V   +  KD++ QSFFLAETLKYL LLFS  +V+ LDEWVFNTEAHPL I
Sbjct:  427 ILDKMVRTSPGGLTYVSDLKFDRLEHKMDHLACFSGGLFALGAATRQNDYTDKYMEVGKGITNTCHESYIRAPTQLGPEAFRFSEAVEARALRSQEKYYILRPETFESYFVLWRLTHDQKYRDWGWEAVLALEKHCRTAHGYCGLRNVYQQEPQKDDVQQSFFLAETLKYLYLLFSDDSVLPLDEWVFNTEAHPLPI 623          
BLAST of CX286936 vs. ExPASy Swiss-Prot
Match: MA121_DROME (Mannosyl-oligosaccharide alpha-1,2-mannosidase isoform A OS=Drosophila melanogaster GN=alpha-Man-I PE=1 SV=2)

HSP 1 Score: 167.548 bits (423), Expect = 4.818e-41
Identity = 88/197 (44.67%), Postives = 123/197 (62.44%), Query Frame = 1
Query:   13 LLSLVRRSTPSSFTYICEKNGDSLIDKMDELACFAPGMIALGSSGYGPGDSEKFLSLAEELAWTCYNFYQSTPTKLAGENYFFRDGQDMSVGTS---WNILRPETVESLFYLWRLTGNKTYKEWGWNIFQAFEKNSRIESGYVGLKDVNTGD--KDNMMQSFFLAETLKYLXLLFSPTTVISLDEWVFNTEAHPLKI 588
            +L  + R++P   TY+ +   D L  KMD LACF+ G+ ALG++      ++K++ + + +  TC+  Y   PT+L  E + F +  +     S   + ILRPET ES F LWRLT ++ Y++WGW    A EK+ R   GY GL++V   +  KD++ QSFFLAETLKYL LLFS  +V+ LDEWVFNTEAHPL I
Sbjct:  451 ILDKMVRTSPGGLTYVSDLKFDRLEHKMDHLACFSGGLFALGAATRQNDYTDKYMEVGKGITNTCHESYIRAPTQLGPEAFRFSEAVEARALRSQEKYYILRPETFESYFVLWRLTHDQKYRDWGWEAVLALEKHCRTAHGYCGLRNVYQQEPQKDDVQQSFFLAETLKYLYLLFSDDSVLPLDEWVFNTEAHPLPI 647          
BLAST of CX286936 vs. ExPASy Swiss-Prot
Match: MA1A1_MOUSE (Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus GN=Man1a1 PE=1 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.073e-40
Identity = 89/206 (43.20%), Postives = 122/206 (59.22%), Query Frame = 1
Query:   22 LVRRSTPSSFTYICEKNGDSLIDKMDELACFAPGMIALGSSGYGPGDSEKFLSLAEELAWTCYNFYQSTPTKLAGENYFFRDGQDMSVGTSWN----ILRPETVESLFYLWRLTGNKTYKEWGWNIFQAFEKNSRIESGYVGLKDVNTGDK--DNMMQSFFLAETLKYLXLLFSPTTVISLDEWVFNTEAHPLKIVTQRDGEISGR 621
            L+R+S+    TYI E  G  L  KM  L CFA GM ALG+ G     ++ +L L  E+A TC+  Y  T  KL  E + F DG   ++ T  N    ILRPE +E+  Y+WRLT +  Y+ W W   +A E + R+  GY GL+DV    +  D++ QSFFLAETLKYL L+FS   ++ L+ W+FNTEAHP  I+ ++  EI G+
Sbjct:  450 LIRKSS-GGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADGAPEARAQHYLELGAEIARTCHESYNRTYVKLGPEAFRF-DGGVEAIATRQNEKYYILRPEVIETYMYMWRLTHDPKYRTWAWEAVEALESHCRVNGGYSGLRDVYIARESYDDVQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNTEAHPFPILREQKKEIDGK 653          
BLAST of CX286936 vs. ExPASy Swiss-Prot
Match: MA1A1_RABIT (Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (Fragment) OS=Oryctolagus cuniculus GN=MAN1A1 PE=1 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 6.957e-40
Identity = 92/203 (45.32%), Postives = 122/203 (60.10%), Query Frame = 1
Query:   22 LVRRSTPSSFTYICEKNGDSLIDKMDELACFAPGMIALGSSGYGPGDSEKFLSLAEELAWTCYNFYQSTPTKLAGENYFFRDGQDMSVGTSWN----ILRPETVESLFYLWRLTGNKTYKEWGWNIFQAFEKNSRIESGYVGLKDVN-TGDK-DNMMQSFFLAETLKYLXLLFSPTTVISLDEWVFNTEAHPLKIVTQRDGEI 612
            L+R+S+    TYI E  G  L  KM  L CFA GM ALG+ G   G ++ +L L  E+A TC+  Y  T  KL  E + F DG   ++ T  N    ILRPE VE+  Y+WRLT +  Y++W W   +A E + R+  GY GL+DV  T +K DN+ QSFFLAETLKYL L+FS   ++ L+ W+FNTEAH L I+     E+
Sbjct:  264 LIRKSS-GGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADGAPEGRAQHYLELGAEIARTCHESYNRTFMKLGPEAFRF-DGGVEAIATRQNEKYYILRPEVVETYMYMWRLTHDPKYRKWAWEAVEALESHCRVNGGYSGLRDVYFTHEKYDNVQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNTEAHLLPILPTDQKEV 464          
BLAST of CX286936 vs. ExPASy Swiss-Prot
Match: MA1A1_PIG (Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Sus scrofa GN=MAN1A1 PE=1 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 6.957e-40
Identity = 88/198 (44.44%), Postives = 121/198 (61.11%), Query Frame = 1
Query:   22 LVRRSTPSSFTYICEKNGDSLIDKMDELACFAPGMIALGSSGYGPGDSEKFLSLAEELAWTCYNFYQSTPTKLAGENYFFRDGQDMSVGTSWN----ILRPETVESLFYLWRLTGNKTYKEWGWNIFQAFEKNSRIESGYVGLKDVNTGDK--DNMMQSFFLAETLKYLXLLFSPTTVISLDEWVFNTEAHPLKIVTQ 597
            L+R+S  +  TYI E  G  L  KM  L CFA GM ALG+     G ++ +L L  E+A TC+  Y  T  KL  E + F DG   ++ T  N    ILRPE VE+  Y+WRLT +  Y++W W   +A EK+ R+  GY GL+DV    +  D++ QSFFLAETLKYL L+FS   ++ L+ W+FNTEAHPL ++++
Sbjct:  454 LIRKSR-NGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADDAPDGLTQHYLQLGAEIARTCHESYSRTFVKLGPEAFRF-DGGVEAIATRQNEKYYILRPEVVETYLYMWRLTHDPKYRKWAWEAVEALEKHCRVNGGYSGLRDVYVSAQTYDDVQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNTEAHPLPVLSR 649          
BLAST of CX286936 vs. ExPASy Swiss-Prot
Match: MAN12_CAEEL (Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 OS=Caenorhabditis elegans GN=C52E4.5 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.644e-39
Identity = 84/196 (42.86%), Postives = 122/196 (62.24%), Query Frame = 1
Query:   22 LVRRSTPSSFTYICEKNGDSLIDKMDELACFAPGMIALGSSGYGPGDSE-KFLSLAEELAWTCYNFYQSTPTKLAGENYFFRDGQDMSVGTSWN--ILRPETVESLFYLWRLTGNKTYKEWGWNIFQAFEKNSRIESGYVGLKDVNT--GDKDNMMQSFFLAETLKYLXLLFSPTTVISLDEWVFNTEAHPLKIVT 594
            +++ S  S+ TY  E N      KM  LACF PGM AL +      + + + ++LAEELA TC+  Y  + T +  E ++F +  + +   S N  I RPE +E  FYLWRLTG   Y++W W+  QA EK  R++SG+ GL++V      ++++MQSFFLAE LKY  L F+  ++ISLD+WVFNTEAHP+ ++T
Sbjct:  394 MIKVSKQSNLTYTVELNNGQAQHKMGHLACFVPGMFALQAINEDTEEEKLRIMTLAEELAKTCHESYIRSETHIGPEMFYFNERDEATSKHSENGYIQRPEVIEGWFYLWRLTGKTMYRDWVWDAVQAIEKYCRVDSGFTGLQNVYNPKAGREDVMQSFFLAEFLKYAYLTFADESLISLDKWVFNTEAHPVPVLT 589          
BLAST of CX286936 vs. ExPASy Swiss-Prot
Match: MA1A2_HUMAN (Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens GN=MAN1A2 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 4.509e-39
Identity = 90/205 (43.90%), Postives = 121/205 (59.02%), Query Frame = 1
Query:   22 LVRRSTPSSFTYICEKNGDSLIDKMDELACFAPGMIALGSSGYGPGDSEKFLSLAEELAWTCYNFYQSTPTKLAGENYFFRDGQDMSVGT----SWNILRPETVESLFYLWRLTGNKTYKEWGWNIFQAFEKNSRIESGYVGLKDV--NTGDKDNMMQSFFLAETLKYLXLLFSPTTVISLDEWVFNTEAHPLKIVTQRDGEISG 618
            L+++S     T+I E     L  KM  LACFA GM ALG+ G     +  +L L  E+A TC+  Y  T  KL  E++ F DG   +V       + ILRPE +E+ +YLWR T +  Y++WGW    A EK  R+  G+ G+KDV  +T   D++ QSFFLAETLKYL LLFS   ++ LD WVFNTEAHPL ++   +  +SG
Sbjct:  434 LIKKSR-GGLTFIGEWKNGHLEKKMGHLACFAGGMFALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKF-DGAVEAVAVRQAEKYYILRPEVIETYWYLWRFTHDPRYRQWGWEAALAIEKYCRVNGGFSGVKDVYSSTPTHDDVQQSFFLAETLKYLYLLFSGDDLLPLDHWVFNTEAHPLPVLHLANTTLSG 636          
BLAST of CX286936 vs. ExPASy Swiss-Prot
Match: MA1A2_MOUSE (Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus GN=Man1a2 PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.714e-38
Identity = 89/205 (43.41%), Postives = 120/205 (58.54%), Query Frame = 1
Query:   22 LVRRSTPSSFTYICEKNGDSLIDKMDELACFAPGMIALGSSGYGPGDSEKFLSLAEELAWTCYNFYQSTPTKLAGENYFFRDGQDMSVGT----SWNILRPETVESLFYLWRLTGNKTYKEWGWNIFQAFEKNSRIESGYVGLKDVN--TGDKDNMMQSFFLAETLKYLXLLFSPTTVISLDEWVFNTEAHPLKIVTQRDGEISG 618
            L+++S      +I E     L  KM  LACFA GM ALG+ G     +  +L L  E+A TC+  Y  T  KL  E++ F DG   +V       + ILRPE +E+ +YLWR T +  Y++WGW    A EK+ R+  G+ G+KDV   T   D++ QSFFLAETLKYL LLFS   ++ LD WVFNTEAHPL ++   +  +SG
Sbjct:  434 LIKKSR-GGLVFIGEWKNGHLERKMGHLACFAGGMFALGADGSRKDKAGHYLELGAEIARTCHESYDRTALKLGPESFKF-DGAVEAVAVRQAEKYYILRPEVIETYWYLWRFTHDPRYRQWGWEAALAIEKSCRVSGGFSGVKDVYAPTPVHDDVQQSFFLAETLKYLYLLFSGDDLLPLDHWVFNTEAHPLPVLRLANSTLSG 636          
BLAST of CX286936 vs. ExPASy Swiss-Prot
Match: MA1A1_HUMAN (Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Homo sapiens GN=MAN1A1 PE=1 SV=3)

HSP 1 Score: 157.147 bits (396), Expect = 6.512e-38
Identity = 88/206 (42.72%), Postives = 121/206 (58.74%), Query Frame = 1
Query:   22 LVRRSTPSSFTYICEKNGDSLIDKMDELACFAPGMIALGSSGYGPGDSEKFLSLAEELAWTCYNFYQSTPTKLAGENYFFRDGQDMSVGTSWN----ILRPETVESLFYLWRLTGNKTYKEWGWNIFQAFEKNSRIESGYVGLKDVNT--GDKDNMMQSFFLAETLKYLXLLFSPTTVISLDEWVFNTEAHPLKIVTQRDGEISGR 621
            L+R+S+ S  TYI E  G  L  KM  L CFA GM ALG+     G ++ +L L  E+A TC+  Y  T  KL  E + F DG   ++ T  N    ILRPE +E+  Y+WRLT +  Y++W W   +A E + R+  GY GL+DV       D++ QSFFLAETLKYL L+FS   ++ L+ W+FN+EAH L I+ +   E+  R
Sbjct:  448 LIRKSS-SGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADAAPEGMAQHYLELGAEIARTCHESYNRTFMKLGPEAFRF-DGGVEAIATRQNEKYYILRPEVMETYMYMWRLTHDPKYRKWAWEAVEALENHCRVNGGYSGLRDVYLLHESYDDVQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNSEAHLLPILPKDKKEVEIR 651          
The following BLAST results are available for this feature:
BLAST of CX286936 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
MA1C1_HUMAN5.147e-4346.27Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC ... [more]
MA122_DROME4.818e-4144.67Mannosyl-oligosaccharide alpha-1,2-mannosidase iso... [more]
MA121_DROME4.818e-4144.67Mannosyl-oligosaccharide alpha-1,2-mannosidase iso... [more]
MA1A1_MOUSE1.073e-4043.20Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA ... [more]
MA1A1_RABIT6.957e-4045.32Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA ... [more]
MA1A1_PIG6.957e-4044.44Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA ... [more]
MAN12_CAEEL2.644e-3942.86Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52... [more]
MA1A2_HUMAN4.509e-3943.90Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB ... [more]
MA1A2_MOUSE1.714e-3843.41Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB ... [more]
MA1A1_HUMAN6.512e-3842.72Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01002G04Rv Veg1 Citrus clementina cDNA clone C01002G04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX286936 ID=CX286936|Name=CX286936|organism=Citrus clementina|type=EST|length=624bp
CTCGTGCCGGGTCTATTAAGCTTGGTTAGGAGATCAACACCATCGTCTTT
TACATACATTTGTGAGAAGAATGGGGACTCGCTGATAGACAAGATGGATG
AATTAGCATGCTTCGCTCCTGGAATGATTGCTTTAGGATCTTCTGGTTAT
GGACCCGGTGACTCTGAGAAATTTCTCTCTCTTGCAGAAGAGCTTGCTTG
GACATGTTATAACTTCTACCAGTCAACACCGACAAAATTGGCTGGAGAGA
ATTACTTCTTTCGTGATGGGCAGGACATGTCTGTGGGCACATCATGGAAC
ATACTGAGACCTGAGACTGTTGAATCACTTTTTTACTTGTGGCGTCTAAC
TGGCAACAAGACATACAAAGAGTGGGGTTGGAACATATTTCAGGCATTCG
AAAAGAACTCCCGAATAGAATCAGGATATGTTGGACTGAAAGATGTTAAT
ACTGGCGACAAAGACAACATGATGCAAAGCTTCTTTCTTGCAGAGACACT
GAAATATCTGNATCTTCTTTTCTCTCCCACAACAGTAATCTCATTAGATG
AGTGGGTTTTCAATACAGAAGCCCACCCATTAAAAATTGTGACCCAACGT
GATGGAGAGATCTCTGGGAGATCG
back to top