CX286943

Overview
NameCX286943
Unique NameCX286943
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length472
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11 contig Ccv1_Contig11:1..472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX286943 vs. ExPASy Swiss-Prot
Match: RH3_ARATH (DEAD-box ATP-dependent RNA helicase 3 OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 1.523e-38
Identity = 75/99 (75.76%), Postives = 87/99 (87.88%), Query Frame = 3
Query:    3 INHEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISKITKLPVLQDDGPSSDNY 299
            ++HE+GWVTLQL RD   +RGF+SARSV GFLSD+Y TAADE+GKI +IADDR+QGAVFDLPEEIAKELL K +P GN++S ITKLP LQDDGPSSDNY
Sbjct:  543 LSHEKGWVTLQLIRDPTNARGFLSARSVTGFLSDLYRTAADEVGKIFLIADDRIQGAVFDLPEEIAKELLEKDVPEGNSLSMITKLPPLQDDGPSSDNY 641          
BLAST of CX286943 vs. ExPASy Swiss-Prot
Match: RH3_ORYSJ (DEAD-box ATP-dependent RNA helicase 3 OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2)

HSP 1 Score: 152.91 bits (385), Expect = 6.399e-37
Identity = 70/99 (70.71%), Postives = 86/99 (86.87%), Query Frame = 3
Query:    3 INHEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISKITKLPVLQDDGPSSDNY 299
            I+HEQGWVTLQLTRD  + RGF S RSV GFLSDV   AADE+GKI + AD++VQGAVFDLPEEIA++LL+ ++PPGNTI+K+TKLP LQDDGP++D+Y
Sbjct:  543 ISHEQGWVTLQLTRDPGYGRGFFSPRSVTGFLSDVSSAAADEVGKIFLTADEKVQGAVFDLPEEIARDLLSMELPPGNTITKVTKLPALQDDGPATDSY 641          
The following BLAST results are available for this feature:
BLAST of CX286943 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
RH3_ARATH1.523e-3875.76DEAD-box ATP-dependent RNA helicase 3 OS=Arabidops... [more]
RH3_ORYSJ6.399e-3770.71DEAD-box ATP-dependent RNA helicase 3 OS=Oryza sat... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01002G12Rv Veg1 Citrus clementina cDNA clone C01002G12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX286943 ID=CX286943|Name=CX286943|organism=Citrus clementina|type=EST|length=472bp
TTATCAACCATGAGCAGGGATGGGTGACATTGCAGTTGACTCGCGATTCA
GCTTTTTCTAGGGGATTTATGTCTGCTAGATCTGTCATGGGATTTCTTTC
TGACGTTTATCCTACAGCTGCCGATGAAATTGGAAAAATACACATAATTG
CAGATGACAGGGTTCAGGGAGCTGTTTTTGATCTTCCGGAGGAGATTGCA
AAGGAGTTGCTAAATAAACAAATACCTCCTGGAAACACCATTTCCAAGAT
CACTAAGTTGCCTGTCTTGCAAGATGATGGGCCCTCAAGCGATAACTATG
GCAGGTTCTCTAGCGGGGATCGCTTTTCCAGAGGAGGAGGTTCTCGCTTT
TCCAGGGGAGGAGCCAGGGGAGGAGGTTCTCGCTTTTCCAGGGGAGGAGC
CAGGGGTGGGAGGTCTGGGCACAGAGCATCTGAATGTCCTAACTGAAATG
ACTTCTAAACCTGTAATTTTGA
back to top