CX287033

Overview
NameCX287033
Unique NameCX287033
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length676
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15176 contig Ccv1_Contig15176:40..715. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287033 vs. ExPASy Swiss-Prot
Match: BI1_ARATH (Bax inhibitor 1 OS=Arabidopsis thaliana GN=BI-1 PE=1 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 2.406e-76
Identity = 139/213 (65.26%), Postives = 166/213 (77.93%), Query Frame = 1
Query:   43 MDAFSSYFESRNGEARW--ESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNIGGLLTVFAMIGSMVWLLATPSYEEKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTVIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDYVKHA 675
            MDAFSS+F+S+ G   W  +SLKNF QISP VQ+HLK+VYL+LCCALVASA G YLH+LWNIGG+LT    IG+M+WLL+ P YE +KR SLL  +A+ +GAS+GPLI +AI +DPSILI+AFVGT +AF CFS AAM+ARRREY                  FASSIFGGS  IFKFELYFGLL+FVGY+VVDTQ+IIEKAH GD+DYVKH+
Sbjct:    1 MDAFSSFFDSQPGSRSWSYDSLKNFRQISPAVQNHLKRVYLTLCCALVASAFGAYLHVLWNIGGILTTIGCIGTMIWLLSCPPYEHQKRLSLLFVSAVLEGASVGPLIKVAIDVDPSILITAFVGTAIAFVCFSAAAMLARRREYLYLGGLLSSGLSMLMWLQFASSIFGGSASIFKFELYFGLLIFVGYMVVDTQEIIEKAHLGDMDYVKHS 213          
BLAST of CX287033 vs. ExPASy Swiss-Prot
Match: BI1_ORYSJ (Bax inhibitor 1 OS=Oryza sativa subsp. japonica GN=BI1 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.372e-62
Identity = 119/214 (55.61%), Postives = 151/214 (70.56%), Query Frame = 1
Query:   43 MDAFSSYFESRNGEAR---WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNIGGLLTVFAMIGSMVWLLATPSYEEKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTVIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDYVKHA 675
            MDAF S   +    A    ++SLKNF QISP VQSHLK VYL+LC AL ASA G YLH+  NIGG+LT+   +GS+ WL + P +EE+KR  +L+A AL +GAS+GPLI LA+  D SIL++AFVGT +AF CF+ AA+VA+RREY                  FA+SIFG ST  F FE+YFGLL+F+GY+V DTQ+IIE+AH GD+DY+KHA
Sbjct:    1 MDAFYSTSSAYGAAASGWGYDSLKNFRQISPAVQSHLKLVYLTLCVALAASAVGAYLHVALNIGGMLTMLGCVGSIAWLFSVPVFEERKRFGILLAAALLEGASVGPLIKLAVDFDSSILVTAFVGTAIAFGCFTCAAIVAKRREYLYLGGLLSSGLSILLWLQFAASIFGHSTGSFMFEVYFGLLIFLGYMVYDTQEIIERAHHGDMDYIKHA 214          
BLAST of CX287033 vs. ExPASy Swiss-Prot
Match: BI1_BOVIN (Bax inhibitor 1 OS=Bos taurus GN=TMBIM6 PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.335e-34
Identity = 80/198 (40.40%), Postives = 116/198 (58.59%), Query Frame = 1
Query:   91 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP-SYE-EKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTVIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDYVKH 672
            +++L  F  I+P  Q HLK+VY S    +  +A G Y+H++ +    GLL+    +G M+WL+ATP S+E E+KR  LL   A   G  +GP +DL I I+PSIL +AF+GT + F CF+++A+ ARRR Y                     ++F GS  +F+  LY GL+V  G+++ DTQ IIEKA  GD DY+ H
Sbjct:   10 FDALFKFSHITPSTQQHLKKVYASFALCMFVAAAGAYIHVVTHFIQAGLLSALGSLGLMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALDLCIAINPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSAMSLMLLSSL-GNLFFGSVWLFQANLYMGLVVMCGFVLFDTQLIIEKAENGDKDYIWH 206          
BLAST of CX287033 vs. ExPASy Swiss-Prot
Match: BI1_PIG (Bax inhibitor 1 OS=Sus scrofa GN=TMBIM6 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.975e-34
Identity = 80/198 (40.40%), Postives = 115/198 (58.08%), Query Frame = 1
Query:   91 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP-SYE-EKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTVIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDYVKH 672
            +++L  F  I+P  Q HLK+VY S    +  +A G Y+H++      GLL+    +G M+WL+ATP S+E E+KR  LL   A   G  +GP +DL I I+PSIL +AF+GT + F CF+++A+ ARRR Y                     ++F GS  +F+  LY GL+V  G+++ DTQ IIEKA  GD DY+ H
Sbjct:   10 FDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTRFIQAGLLSALGSLGLMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALDLCIAINPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSAMSLMVLSSL-GNLFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAENGDKDYIWH 206          
BLAST of CX287033 vs. ExPASy Swiss-Prot
Match: BI1_PAROL (Probable Bax inhibitor 1 OS=Paralichthys olivaceus GN=tmbim6 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.975e-34
Identity = 79/199 (39.70%), Postives = 114/199 (57.29%), Query Frame = 1
Query:   91 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP--SYEEKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTVIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDYVKHA 675
            ++SL  F QIS   Q HLK VY SL   +  +A G Y+H++  +  GG+L+V   +G M WL  TP  S  EKKR ++L   A   G  + P +D  I I+PSI+++AF+GT + F CF+++A+ A+RR Y                    +  F GS ++FK  +Y GLL+  G+++ DTQ IIEKA  GD DYV H+
Sbjct:   10 FDSLFKFSQISHSTQVHLKNVYSSLAVCMFVAAAGSYVHVVTRLFQGGMLSVLGSLGMMFWLAMTPHNSETEKKRLAILAGFAFLTGVGLCPTLDFVIAINPSIIVTAFLGTSVIFVCFTLSALYAKRRSYLFLGGTLMSGLSILFLMSMMNMFF-GSVMLFKAHMYLGLLIMCGFVLXDTQLIIEKAENGDKDYVWHS 207          
BLAST of CX287033 vs. ExPASy Swiss-Prot
Match: BI1_MOUSE (Bax inhibitor 1 OS=Mus musculus GN=Tmbim6 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.885e-34
Identity = 79/198 (39.90%), Postives = 115/198 (58.08%), Query Frame = 1
Query:   91 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP-SYE-EKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTVIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDYVKH 672
            +++L  F  I+P  Q HLK+VY S    +  +A G Y+H++ +    GLL+    +  M+WL+ATP S+E E+KR  LL   A   G  +GP ++L I ++PSIL +AF+GT + F CFS++A+ ARRR Y                     ++F GS  +F+  LY GLLV  G+++ DTQ IIEKA  GD DY+ H
Sbjct:   10 FDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSL-GNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWH 206          
BLAST of CX287033 vs. ExPASy Swiss-Prot
Match: BI1_RAT (Bax inhibitor 1 OS=Rattus norvegicus GN=Tmbim6 PE=2 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 1.250e-32
Identity = 79/198 (39.90%), Postives = 113/198 (57.07%), Query Frame = 1
Query:   91 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP-SYE-EKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTVIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDYVKH 672
            +++L  F  I+P  Q HLK+VY S    +  +A G Y+H++      GLL+    +  M+ L+ATP S+E E+KR  LL   A   G  +GP ++L I I+PSIL +AF+GT + F CFS++A+ ARRR Y                     ++F GS  +F+  LY GLLV  G+++ DTQ IIEKA  GD DY+ H
Sbjct:   10 FDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTRFIQAGLLSALGALALMICLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAINPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMFVSSL-GNLFFGSIWLFQANLYMGLLVMCGFVLFDTQLIIEKAEHGDKDYIWH 206          
BLAST of CX287033 vs. ExPASy Swiss-Prot
Match: BI1_HUMAN (Bax inhibitor 1 OS=Homo sapiens GN=TMBIM6 PE=1 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 1.250e-32
Identity = 76/198 (38.38%), Postives = 114/198 (57.58%), Query Frame = 1
Query:   91 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP-SYE-EKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTVIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDYVKH 672
            +++L  F  I+P  Q HLK+VY S    +  +A G Y+H++ +    GLL+    +  M+WL+ATP S+E E+KR  LL   A   G  +GP ++  I ++PSIL +AF+GT + F CF+++A+ ARRR Y                     ++F GS  +F+  LY GL+V  G+++ DTQ IIEKA  GD DY+ H
Sbjct:   10 FDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSL-GNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWH 206          
BLAST of CX287033 vs. ExPASy Swiss-Prot
Match: BI1_PONAB (Bax inhibitor 1 OS=Pongo abelii GN=TMBIM6 PE=2 SV=2)

HSP 1 Score: 139.428 bits (350), Expect = 1.632e-32
Identity = 76/198 (38.38%), Postives = 114/198 (57.58%), Query Frame = 1
Query:   91 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP-SYE-EKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTVIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDYVKH 672
            +++L  F  I+P  Q HLK+VY S    +  +A G Y+H++ +    GLL+    +  M+WL+ATP S+E E+KR  LL   A   G  +GP ++  I ++PSIL +AF+GT + F CF+++A+ ARRR Y                     ++F GS  +F+  LY GL+V  G+++ DTQ IIEKA  GD DY+ H
Sbjct:   10 FDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCITVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSL-GNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWH 206          
BLAST of CX287033 vs. ExPASy Swiss-Prot
Match: BI1_DROME (Probable Bax inhibitor 1 OS=Drosophila melanogaster GN=CG7188 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.368e-15
Identity = 55/189 (29.10%), Postives = 92/189 (48.68%), Query Frame = 1
Query:  124 PVVQSHLKQVYLSLCCALVASATGVYLHLLWNIGGLLTVFAMIGSMVWLLATPSYEEK-----KRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTVIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDYVKHA 675
            P V+ HL +VY+ L     A+A G  L +   +   L V A + ++V +L    Y++       R  +L A     G ++GPL+     I+P+I++SA  GT + F   S++A++A + +Y                    + +F  S  +   +LY G+ V   +IV DTQ+I+EK   G+ D V+HA
Sbjct:   25 PYVREHLSKVYMVLGSTAAATAMGAMLQMRDFLD--LGVLAAVATLVLVLGLHFYKDDGKNYYTRLGMLYAFGFCSGQTLGPLLGYICSINPAIILSALTGTFVTFISLSLSALLAEQGKYLYLGGMLVSVINTMALLSLFNMVF-KSYFVQVTQLYVGVFVMAAFIVYDTQNIVEKCRNGNRDVVQHA 210          
The following BLAST results are available for this feature:
BLAST of CX287033 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
BI1_ARATH2.406e-7665.26Bax inhibitor 1 OS=Arabidopsis thaliana GN=BI-1 PE... [more]
BI1_ORYSJ3.372e-6255.61Bax inhibitor 1 OS=Oryza sativa subsp. japonica GN... [more]
BI1_BOVIN1.335e-3440.40Bax inhibitor 1 OS=Bos taurus GN=TMBIM6 PE=2 SV=1[more]
BI1_PIG2.975e-3440.40Bax inhibitor 1 OS=Sus scrofa GN=TMBIM6 PE=2 SV=1[more]
BI1_PAROL2.975e-3439.70Probable Bax inhibitor 1 OS=Paralichthys olivaceus... [more]
BI1_MOUSE3.885e-3439.90Bax inhibitor 1 OS=Mus musculus GN=Tmbim6 PE=2 SV=... [more]
BI1_RAT1.250e-3239.90Bax inhibitor 1 OS=Rattus norvegicus GN=Tmbim6 PE=... [more]
BI1_HUMAN1.250e-3238.38Bax inhibitor 1 OS=Homo sapiens GN=TMBIM6 PE=1 SV=... [more]
BI1_PONAB1.632e-3238.38Bax inhibitor 1 OS=Pongo abelii GN=TMBIM6 PE=2 SV=... [more]
BI1_DROME2.368e-1529.10Probable Bax inhibitor 1 OS=Drosophila melanogaste... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01003H01SK Veg1 Citrus clementina cDNA clone C01003H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287033 ID=CX287033; Name=CX287033; organism=Citrus clementina; type=EST; length=676bp
CTCGAGTTTTCTTTTTCGGACAAGCAACGTCAATAATCAAGAATGGATGC
TTTCTCTTCCTACTTCGAGTCTCGTAACGGCGAAGCCCGCTGGGAGTCCT
TGAAAAACTTTCACCAGATCTCTCCCGTCGTCCAGTCTCACCTTAAGCAG
GTTTATCTGTCATTATGCTGTGCACTGGTGGCATCAGCCACTGGAGTCTA
CCTCCATCTCCTCTGGAACATTGGTGGCTTACTTACGGTTTTTGCAATGA
TTGGATCAATGGTTTGGCTTCTCGCAACCCCTAGTTATGAAGAGAAAAAG
AGGGCTTCTCTGCTCATGGCTACCGCTCTCTTTAAAGGTGCATCAATTGG
TCCTTTGATTGATCTCGCCATTCAAATTGACCCAAGCATTCTGATATCTG
CATTTGTGGGAACCGGGCTGGCTTTCGCTTGTTTTTCTGTAGCTGCCATG
GTTGCAAGGCGGAGAGAGTATCTCTATCTTGGTGGCTTGCTTTCATCAGG
CCTGTCCATGCTTCTTTGGTTGCATTTTGCTTCCTCTATCTTTGGTGGTT
CAACAGTTATCTTCAAGTTTGAGTTATACTTTGGGCTGTTGGTGTTTGTT
GGCTACATCGTGGTGGATACCCAGGATATAATTGAGAAAGCTCACTTTGG
AGACTTGGATTATGTCAAGCATGCCC
back to top