CX287034

Overview
NameCX287034
Unique NameCX287034
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length657
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig4226 contig Ccv1_Contig4226:131..787. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287034 vs. ExPASy Swiss-Prot
Match: PEX7_DICDI (Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum GN=pex7 PE=3 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 3.007e-52
Identity = 95/196 (48.47%), Postives = 133/196 (67.86%), Query Frame = 3
Query:   69 MPVFKTPFNGYSVKFSPFYESRLAVATAQNFGILGNGRVHVLDLSPAAPALTELVAFDTADGVYDLAWSESHDSLLIAAVADGSVKIYDTALPPTANPIRSLHEHTREVHSADYNPTRRDSFITSSWDDTVKLWTVDRPTSVRTFKEHAYCVYNATWNPRHSDVFCSASGDCTLRIWDVREMGSTMIIPAHEFEIL 656
            M  F + FNGYSV+FSPF E RLA  T+Q+FGI+GNGR ++LD+      +     FDT DG+YD  WSE ++  + ++  DGS+KI+DT  P    PI+S  EHT+EV+S D+N   +D+FIT SWD ++K+W      S++TF+EH YC+Y+A W+PR++ +F S SGD TL+IWD R+  S   I AH+ EIL
Sbjct:    1 MKRFHSHFNGYSVEFSPFEEQRLACVTSQHFGIIGNGRQYILDVLDRD--IGAFKTFDTRDGLYDCTWSEENECHVASSSGDGSIKIWDTQAPSGGRPIKSFEEHTKEVYSVDWNLVTKDTFITGSWDQSIKIWNPRMDRSLKTFREHRYCIYSAIWSPRNAHLFASVSGDRTLKIWDSRDNRSLNTIKAHDHEIL 194          
BLAST of CX287034 vs. ExPASy Swiss-Prot
Match: PEX7_HUMAN (Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.235e-39
Identity = 83/189 (43.92%), Postives = 120/189 (63.49%), Query Frame = 3
Query:   93 NGYSVKFSPFYESRLAVATAQNFGILGNGRVHVLDLSPAAPALTELVAFDTADGVYDLAWSESHDSLLIAAVADGSVKIYDTALPPTANPIRSLHEHTREVHSADYNPTRRDSFITS-SWDDTVKLWTVDRPTSVRTFKEHAYCVYNATWNPRHSDVFCSASGDCTLRIWDVREMGSTMIIPAHEFEIL 656
            +GY+ +FSP+   RLA ATAQ++GI G G + +LD  P    L    +FD  DG++D+ WSE+++ +LI    DGS++++DTA    A P++   EH +EV+S D++ TR +  + S SWD TVKLW      S+ TF+ H   +Y+  W+P     F SASGD TLRIWDV+  G  ++IPAH+ EIL
Sbjct:   18 HGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILD--PDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWDTA--KAAGPLQVYKEHAQEVYSVDWSQTRGEQLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPHIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAEIL 202          
BLAST of CX287034 vs. ExPASy Swiss-Prot
Match: PEX7_CRIGR (Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.471e-38
Identity = 79/189 (41.80%), Postives = 120/189 (63.49%), Query Frame = 3
Query:   93 NGYSVKFSPFYESRLAVATAQNFGILGNGRVHVLDLSPAAPALTELVAFDTADGVYDLAWSESHDSLLIAAVADGSVKIYDTALPPTANPIRSLHEHTREVHSADYNPTRRDSFITS-SWDDTVKLWTVDRPTSVRTFKEHAYCVYNATWNPRHSDVFCSASGDCTLRIWDVREMGSTMIIPAHEFEIL 656
            +GY+ +FSP+   RLA A AQ++GI G G + +LD + +   L    +FD +DG++D+ WSE ++ +L+    DGS++++DTA      P++   EHT+EV+S D++ TR +  + S SWD TVK+W      S+ TF+ H   +Y+  W+P     F SASGD TLRIWDV+  G  ++IPAH+ EIL
Sbjct:   13 HGYAAEFSPYLPGRLACAAAQHYGIAGCGTLIILDQNQSG--LQIFRSFDWSDGLFDVTWSEDNEHVLVTCSGDGSLQLWDTA--KATGPLQVYKEHTQEVYSVDWSQTRGEQLVVSGSWDQTVKVWDPTVGNSLCTFRGHESVIYSTIWSPHIPGCFASASGDQTLRIWDVKTAGVRIVIPAHQTEIL 197          
BLAST of CX287034 vs. ExPASy Swiss-Prot
Match: PEX7_MOUSE (Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 3.227e-38
Identity = 80/189 (42.33%), Postives = 120/189 (63.49%), Query Frame = 3
Query:   93 NGYSVKFSPFYESRLAVATAQNFGILGNGRVHVLDLSPAAPALTELVAFDTADGVYDLAWSESHDSLLIAAVADGSVKIYDTALPPTANPIRSLHEHTREVHSADYNPTRRDSFITS-SWDDTVKLWTVDRPTSVRTFKEHAYCVYNATWNPRHSDVFCSASGDCTLRIWDVREMGSTMIIPAHEFEIL 656
            +GY+ +FSP+   RLA A AQ++GI G G + VLD + +   L    +FD  DG++D+ WSE+++ +L+    DGS++++DTA      P++   EHT+EV+S D++ TR +  + S SWD TVK+W      S+ TF+ H   +Y+  W+P     F SASGD TLRIWDV+  G  ++IPAH+ EIL
Sbjct:   13 HGYAAEFSPYLPGRLACAAAQHYGIAGCGTLLVLDQNESG--LQIFRSFDWNDGLFDVTWSENNEHVLVTCSGDGSLQLWDTA--KATGPLQVYKEHTQEVYSVDWSQTRGEQLVVSGSWDQTVKVWDPTVGNSLCTFRGHESVIYSTIWSPHIPGCFASASGDQTLRIWDVKTTGVRIVIPAHQTEIL 197          
BLAST of CX287034 vs. ExPASy Swiss-Prot
Match: PEX7_YEAST (Peroxisomal targeting signal 2 receptor OS=Saccharomyces cerevisiae GN=PEX7 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.738e-29
Identity = 65/200 (32.50%), Postives = 114/200 (57.00%), Query Frame = 3
Query:   90 FNGYSVKFSPFYESRLAVATAQNFGILGNGRVHVLDLSPAAPALTELVAFDTADGVYDLAWSESHDSLLIAAVADGSVKIYDTALPPTANPIRSLHEHTREVHSADYNPTRRDSFITSSWDDTVKLWTVDRPTSVRTF---------------------------KEHAYCVYNATWNPRHSDVFCSASGDCTLRIWDVR 608
            F+GY V++SPF+++RLAVA   NFG++GNG++ +L++  +   + E+ +F T D ++DLAW+ESH++ ++ A  DG+++++DT       PI    EH REV S ++N   R +F++SSWD ++K+W+  R  S+ T                             ++  CVY A ++P   ++  S SG+    ++D+R
Sbjct:    9 FSGYGVQYSPFFDNRLAVAAGSNFGLVGNGKLFILEIDRSG-RIVEVNSFLTQDCLFDLAWNESHENQVLVAQGDGTLRLFDTTFKEF--PIAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMTLTPRPLEITKMVDPLNAIILKKKSFTGISKNRNCVYQAQFSPHDQNLVLSCSGNSYASLFDIR 205          
BLAST of CX287034 vs. ExPASy Swiss-Prot
Match: PEX7_PICPA (Peroxisomal targeting signal 2 receptor OS=Pichia pastoris GN=PEX7 PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 8.809e-28
Identity = 65/210 (30.95%), Postives = 118/210 (56.19%), Query Frame = 3
Query:   90 FNGYSVKFSPFYESRLAVATAQNFGILGNGRVHVLDLSPAAPALTELVAFDTADGVYDLAWSESHDSLLIAAVADGSVKIYDTALPPTANPIRSLHEHTREVHSADYNPTRRDSFITSSWDDTVKLWT--VDRPTSVRTFKEHAY-----------------------------------CVYNATWNPRHSDVFCSASGDCTLRIWDVR 608
            F+GY+V++SPFY++++AVAT+ N+G++GNGR++VL +      +T+ +++DT DG++ +AWSE++++ ++ +  DG V ++DT L     P+    EH REV S D++   ++ F ++SWD +VK+W+   +R TS+ T +  A                                    CVY+A ++    ++  S + D  L++WD R
Sbjct:    9 FSGYAVRYSPFYDNKIAVATSANYGLVGNGRLYVLSIMDDGNIITD-ISYDTQDGLFGVAWSETNENHVLTSSGDGCVSLFDTTLKD--YPVMKFTEHQREVFSVDWSNIDKNLFCSASWDGSVKVWSPGSNRNTSLLTLRSLASREEKTGRIEKPIPVVQPSQVPMSKTRPNIRNDNNDCVYDAKFSFHDPNIIMSCNSDSHLQLWDTR 215          
BLAST of CX287034 vs. ExPASy Swiss-Prot
Match: PEX7_SCHPO (Peroxisomal targeting signal 2 receptor OS=Schizosaccharomyces pombe GN=pex7 PE=2 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 1.232e-21
Identity = 56/186 (30.11%), Postives = 99/186 (53.23%), Query Frame = 3
Query:   81 KTP-FNGYSVKFSPFYESRLAVATAQNFGILGNGRVHVLDLSPAAPALTELVAFDTADGVYDLAWSESHDSLLIAAVADGSVKIYDTALPPTANPIRSLHEHTREVHSADYNPTRRDSFITSSWDDTVKLWTVDRPTSVRTFKEHAYC-VYNATWNPRHSDVFCSASGDCTLRIWDVREMGSTMII 632
            +TP F G SV+FSP  E+++AVA   ++G+ G+GR+++ D++P    + +   +D  D ++ + WS++ ++ + A   DGS++++D  +P  + PI    EH  E+ + D N   R   +T SWD T+KLW  + P SV+T    +   +     +    ++    S D   + WD R     M I
Sbjct:    5 RTPGFQGESVQFSPLVENKIAVAAVTHYGLGGSGRLYIHDVTPKGIQVCQ--HYDVEDSLFGVRWSQNCENQVYACCGDGSLRLFDLTMP--SKPIHKWKEHKAEIVAIDTNTVDRRIVVTGSWDGTIKLWLGNLPNSVQTLNNGSNSRILTVATHYSSPNLLGYTSSDGLCKFWDFRSSDKFMSI 186          
BLAST of CX287034 vs. ExPASy Swiss-Prot
Match: RBBP7_XENTR (Histone-binding protein RBBP7 OS=Xenopus tropicalis GN=rbbp7 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.365e-12
Identity = 37/122 (30.33%), Postives = 61/122 (50.00%), Query Frame = 3
Query:  255 VYDLAWSESHDSLLIAAVADGSVKIYDTALPPTANPIRSLHEHTREVHSADYNPTRRDSFITSSWDDTVKLWTV-DRPTSVRTFKEHAYCVYNATWNPRHSDVFCSASGDCTLRIWDVREMG 617
            V D+AW   H+SL  +   D  + I+DT    T+ P  S+  HT EV+   +NP       T S D TV LW + +    + +F+ H   ++   W+P +  +  S+  D  L +WD+ ++G
Sbjct:  229 VEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIG 350          
BLAST of CX287034 vs. ExPASy Swiss-Prot
Match: RBBP7_XENLA (Histone-binding protein RBBP7 OS=Xenopus laevis GN=rbbp7 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.365e-12
Identity = 37/122 (30.33%), Postives = 61/122 (50.00%), Query Frame = 3
Query:  255 VYDLAWSESHDSLLIAAVADGSVKIYDTALPPTANPIRSLHEHTREVHSADYNPTRRDSFITSSWDDTVKLWTV-DRPTSVRTFKEHAYCVYNATWNPRHSDVFCSASGDCTLRIWDVREMG 617
            V D+AW   H+SL  +   D  + I+DT    T+ P  S+  HT EV+   +NP       T S D TV LW + +    + +F+ H   ++   W+P +  +  S+  D  L +WD+ ++G
Sbjct:  229 VEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIG 350          
BLAST of CX287034 vs. ExPASy Swiss-Prot
Match: RBBP7_CHICK (Histone-binding protein RBBP7 OS=Gallus gallus GN=RBBP7 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.365e-12
Identity = 37/122 (30.33%), Postives = 61/122 (50.00%), Query Frame = 3
Query:  255 VYDLAWSESHDSLLIAAVADGSVKIYDTALPPTANPIRSLHEHTREVHSADYNPTRRDSFITSSWDDTVKLWTV-DRPTSVRTFKEHAYCVYNATWNPRHSDVFCSASGDCTLRIWDVREMG 617
            V D+AW   H+SL  +   D  + I+DT    T+ P  S+  HT EV+   +NP       T S D TV LW + +    + +F+ H   ++   W+P +  +  S+  D  L +WD+ ++G
Sbjct:  228 VEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIG 349          
The following BLAST results are available for this feature:
BLAST of CX287034 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
PEX7_DICDI3.007e-5248.47Peroxisomal targeting signal 2 receptor OS=Dictyos... [more]
PEX7_HUMAN2.235e-3943.92Peroxisomal targeting signal 2 receptor OS=Homo sa... [more]
PEX7_CRIGR2.471e-3841.80Peroxisomal targeting signal 2 receptor OS=Cricetu... [more]
PEX7_MOUSE3.227e-3842.33Peroxisomal targeting signal 2 receptor OS=Mus mus... [more]
PEX7_YEAST2.738e-2932.50Peroxisomal targeting signal 2 receptor OS=Sacchar... [more]
PEX7_PICPA8.809e-2830.95Peroxisomal targeting signal 2 receptor OS=Pichia ... [more]
PEX7_SCHPO1.232e-2130.11Peroxisomal targeting signal 2 receptor OS=Schizos... [more]
RBBP7_XENTR1.365e-1230.33Histone-binding protein RBBP7 OS=Xenopus tropicali... [more]
RBBP7_XENLA1.365e-1230.33Histone-binding protein RBBP7 OS=Xenopus laevis GN... [more]
RBBP7_CHICK1.365e-1230.33Histone-binding protein RBBP7 OS=Gallus gallus GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01003H02SK Veg1 Citrus clementina cDNA clone C01003H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287034 ID=CX287034; Name=CX287034; organism=Citrus clementina; type=EST; length=657bp
ACGAGGACCAGATGAAACTTGAGTACAGATAACTCCGTCAACTCCACCGG
CAAATAACAACACCAAAGATGCCCGTCTTCAAAACCCCATTTAACGGCTA
CTCCGTCAAATTCTCTCCCTTCTACGAGTCCCGTCTCGCCGTTGCCACCG
CCCAAAACTTCGGAATCCTCGGTAATGGCCGCGTCCACGTCCTCGACCTC
TCCCCCGCCGCTCCCGCTCTCACCGAACTCGTCGCCTTCGACACTGCCGA
CGGTGTTTACGACCTCGCATGGTCCGAATCCCACGACTCCCTCCTAATCG
CCGCCGTCGCCGATGGATCCGTTAAAATCTACGACACGGCCCTCCCGCCA
ACGGCCAATCCCATCCGCTCCCTCCACGAGCACACTCGCGAAGTCCACTC
GGCCGATTATAACCCCACTCGACGTGATTCTTTCATCACATCGTCCTGGG
ATGACACGGTTAAACTCTGGACCGTTGACCGGCCTACCAGTGTGCGAACA
TTTAAAGAACACGCGTATTGCGTGTACAACGCCACGTGGAACCCGCGTCA
CAGCGACGTGTTCTGTTCCGCGAGTGGGGACTGCACTCTTCGAATTTGGG
ATGTGAGAGAGATGGGCAGCACGATGATAATTCCGGCACACGAGTTTGAA
ATTTTAG
back to top