CX287042

Overview
NameCX287042
Unique NameCX287042
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length516
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15523 contig Ccv1_Contig15523:272..787. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287042 vs. ExPASy Swiss-Prot
Match: AB5F_ARATH (ABC transporter F family member 5 OS=Arabidopsis thaliana GN=ABCF5 PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 5.145e-76
Identity = 140/171 (81.87%), Postives = 152/171 (88.89%), Query Frame = 2
Query:    2 MSRTVREEFMSAFKEEMEIAGKLERVQKALESAVDDMDLMGRLLDEFDLLQRKAQAVNLDTLDAKVSKLMPELGFTADDGDRLVASFSSGWQMRMSLGKIXXXXXXXXXXXEPTNHLDLDTIEWLEGYLGKQDVPMVIISHDRAFLDQLCTKIVETEMGVSRTYEGNYSQY 514
            MS+TVREEFM+AFKEEMEI  KLE+VQKA+E +VDD+DLMGRLLDEFDLLQR+AQAVNLD++DAK+SKLMPELGF  +D DRLVASFS GWQMRMSLGKI           EPTNHLDLDTIEWLEGYL KQDVPMVIISHDRAFLDQLCTKIVETEMGVSRT+EGNYSQY
Sbjct:  174 MSKTVREEFMTAFKEEMEITEKLEKVQKAIEGSVDDLDLMGRLLDEFDLLQRRAQAVNLDSVDAKISKLMPELGFAPEDADRLVASFSGGWQMRMSLGKILLQDPDLLLLDEPTNHLDLDTIEWLEGYLQKQDVPMVIISHDRAFLDQLCTKIVETEMGVSRTFEGNYSQY 344          

HSP 2 Score: 66.6254 bits (161), Expect = 7.568e-11
Identity = 34/106 (32.08%), Postives = 54/106 (50.94%), Query Frame = 2
Query:  197 VSKLMPELGFTADDGDRLVASFSSGWQMRMSLGKIXXXXXXXXXXXEPTNHLDLDTIEWLEGYLGKQDVPMVIISHDRAFLDQLCTKIVETEMGVSRTYEGNYSQY 514
            +  L+    F AD  DR V+  S G + R++  K            EPTNHLD+ + E LE  + +    ++ +SHDR F+ Q+  +++E E G    Y G+Y+ Y
Sbjct:  523 IKGLLGRCNFKADMLDRKVSLLSGGEKARLAFCKFMVTPSTLLVLDEPTNHLDIPSKEMLEEAINEYQGTVIAVSHDRYFIKQIVNRVIEVEDGCLEDYAGDYNYY 628          
BLAST of CX287042 vs. ExPASy Swiss-Prot
Match: AB2F_ARATH (ABC transporter F family member 2 OS=Arabidopsis thaliana GN=ABCF2 PE=3 SV=2)

HSP 1 Score: 267.314 bits (682), Expect = 2.921e-71
Identity = 132/171 (77.19%), Postives = 148/171 (86.55%), Query Frame = 2
Query:    2 MSRTVREEFMSAFKEEMEIAGKLERVQKALESAVDDMDLMGRLLDEFDLLQRKAQAVNLDTLDAKVSKLMPELGFTADDGDRLVASFSSGWQMRMSLGKIXXXXXXXXXXXEPTNHLDLDTIEWLEGYLGKQDVPMVIISHDRAFLDQLCTKIVETEMGVSRTYEGNYSQY 514
            M +TV+EEFM  FKEEMEIA KLE +QKA+E AVDD++LMG+LLDEFDLLQR+AQ V+LD++ AK+SKLM ELGF ++D DRLVASFSSGWQMRMSLGKI           EPTNHLDLDTIEWLEGYL KQDVPMVIISHDRAFLDQLCTKIVETEMGVSRT++GNYSQY
Sbjct:  160 MGKTVKEEFMCTFKEEMEIARKLENLQKAIEEAVDDLELMGKLLDEFDLLQRRAQEVDLDSIHAKISKLMSELGFVSEDADRLVASFSSGWQMRMSLGKILLQNPDLLLLDEPTNHLDLDTIEWLEGYLIKQDVPMVIISHDRAFLDQLCTKIVETEMGVSRTFDGNYSQY 330          
BLAST of CX287042 vs. ExPASy Swiss-Prot
Match: AB4F_ARATH (ABC transporter F family member 4 OS=Arabidopsis thaliana GN=ABCF4 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.376e-20
Identity = 59/169 (34.91%), Postives = 89/169 (52.66%), Query Frame = 2
Query:   29 MSAFKEEMEIAGKLERVQKALESA-------VDDMDLMGRLLDEFDLLQRKAQAVNLDTLDAKVSKLMPELGFTADDGDRLVASFSSGWQMRMSLGKIXXXXXXXXXXXEPTNHLDLDTIEWLEGYLGKQDVPMVIISHDRAFLDQLCTKIVETEMGVSRTYEGNYSQY 514
            +SA +E +++  + E +QK+   A        DD D   +L + +D LQ     +  D  +A+ SK++  LGFT D   R   SFS GW+MR+SL +            EPTNHLDL  + WLE YL +    +V++SHDR FL+ +CT+I+         Y GN+  +
Sbjct:  240 VSANEELVKLREEAEALQKSSSGADGENVDGEDDDDTGEKLAELYDRLQ----ILGSDAAEAQASKILAGLGFTKDMQVRATQSFSGGWRMRISLARALFVQPTLLLLDEPTNHLDLRAVLWLEEYLCRWKKTLVVVSHDRDFLNTVCTEIIHLHDQNLHFYRGNFDGF 404          
BLAST of CX287042 vs. ExPASy Swiss-Prot
Match: YDIF_BACSU (Uncharacterized ABC transporter ATP-binding protein ydiF OS=Bacillus subtilis GN=ydiF PE=3 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 3.066e-20
Identity = 53/168 (31.55%), Postives = 90/168 (53.57%), Query Frame = 2
Query:   11 TVREEFMSAFKEEMEIAGKLERVQKALESAVDDMDLMGRLLDEFDLLQRKAQAVNLDTLDAKVSKLMPELGFTADDGDRLVASFSSGWQMRMSLGKIXXXXXXXXXXXEPTNHLDLDTIEWLEGYLGKQDVPMVIISHDRAFLDQLCTKIVETEMGVSRTYEGNYSQY 514
            T++EE ++ F     +  ++  +++ + +A  D   +  ++  +D LQ++ +       +A V  ++  LGF+  D    V S S G + R++LGK+           EPTNHLD+DT+ WLE YL      ++I+SHDR FLD++  ++ E     S+ Y GNYS Y
Sbjct:   82 TIKEELLTVFDHLKAMEKEMRAMEEKMAAA--DPGELESIMKTYDRLQQEFKDKGGYQYEADVRSVLHGLGFSHFDDSTQVQSLSGGQKTRLALGKLLLTQPDLLILDEPTNHLDIDTLTWLEHYLQGYSGAILIVSHDRYFLDKVVNQVYEVSRAESKKYHGNYSAY 247          
BLAST of CX287042 vs. ExPASy Swiss-Prot
Match: UUP_ECOLI (ABC transporter ATP-binding protein uup OS=Escherichia coli (strain K12) GN=uup PE=1 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 1.288e-18
Identity = 46/128 (35.94%), Postives = 76/128 (59.38%), Query Frame = 2
Query:  131 LDEFDLLQRKAQAVNLDTLDAKVSKLMPELGFTADDGDRLVASFSSGWQMRMSLGKIXXXXXXXXXXXEPTNHLDLDTIEWLEGYLGKQDVPMVIISHDRAFLDQLCTKIVETEMGVSRTYEGNYSQY 514
            L+E   +Q +    NL  L+ ++++++ +LG    D +  ++S S GW  + +LG+            EPTNHLD++TI+WLEG+L   +  ++ ISHDR+F+  + T+IV+ + G   TY GNY QY
Sbjct:  117 LNELAKVQEQLDHHNLWQLENRINEVLAQLGL---DPNVALSSLSGGWLRKAALGRALVSNPRVLLLDEPTNHLDIETIDWLEGFLKTFNGTIIFISHDRSFIRNMATRIVDLDRGKLVTYPGNYDQY 241          
BLAST of CX287042 vs. ExPASy Swiss-Prot
Match: YHES_ECOLI (Uncharacterized ABC transporter ATP-binding protein yheS OS=Escherichia coli (strain K12) GN=yheS PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.747e-18
Identity = 44/119 (36.97%), Postives = 68/119 (57.14%), Query Frame = 2
Query:  158 KAQAVNLDTLDAKVSKLMPELGFTADDGDRLVASFSSGWQMRMSLGKIXXXXXXXXXXXEPTNHLDLDTIEWLEGYLGKQDVPMVIISHDRAFLDQLCTKIVETEMGVSRTYEGNYSQY 514
            K  A++  ++ ++ + L+  LGF+ +  +R V+ FS GW+MR++L +            EPTNHLDLD + WLE +L      +++ISHDR FLD +  KI+  E      Y GNYS +
Sbjct:  116 KLDAIDAWSIRSRAASLLHGLGFSNEQLERPVSDFSGGWRMRLNLAQALICRSDLLLLDEPTNHLDLDAVIWLEKWLKSYQGTLILISHDRDFLDPIVDKIIHIEQQSMFEYTGNYSSF 234          
BLAST of CX287042 vs. ExPASy Swiss-Prot
Match: YHES_ECO57 (Uncharacterized ABC transporter ATP-binding protein yheS OS=Escherichia coli O157:H7 GN=yheS PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.747e-18
Identity = 44/119 (36.97%), Postives = 68/119 (57.14%), Query Frame = 2
Query:  158 KAQAVNLDTLDAKVSKLMPELGFTADDGDRLVASFSSGWQMRMSLGKIXXXXXXXXXXXEPTNHLDLDTIEWLEGYLGKQDVPMVIISHDRAFLDQLCTKIVETEMGVSRTYEGNYSQY 514
            K  A++  ++ ++ + L+  LGF+ +  +R V+ FS GW+MR++L +            EPTNHLDLD + WLE +L      +++ISHDR FLD +  KI+  E      Y GNYS +
Sbjct:  116 KLDAIDAWSIRSRAASLLHGLGFSNEQLERPVSDFSGGWRMRLNLAQALICRSDLLLLDEPTNHLDLDAVIWLEKWLKSYQGTLILISHDRDFLDPIVDKIIHIEQQSMFEYTGNYSSF 234          
BLAST of CX287042 vs. ExPASy Swiss-Prot
Match: ABCF2_DICDI (ABC transporter F family member 2 OS=Dictyostelium discoideum GN=abcF2 PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.090e-17
Identity = 57/161 (35.40%), Postives = 79/161 (49.07%), Query Frame = 2
Query:   86 ALESAVDDMD--------LMGRLLDE--------FDLLQRKAQAVNLD--TLDAKVSKLMPELGFTADDGDRLVASFSSGWQMRMSLGKIXXXXXXXXXXXEPTNHLDLDTIEWLEGYLGKQDVPMVIISHDRAFLDQLCTKIVETEMGVSRTYEGNYSQY 514
            AL+S +DD +        L  RLL+E        FD+ +R     NLD  T   + S+++  LGFT+    +     S GW+MR+SL K            EPTNHLDL    WLE YL   D  ++IISH + FL+ +CT I+       + Y GNY  +
Sbjct:  125 ALQSVIDDAEKEVKRLEVLEERLLEEQGPESEELFDVYERLE---NLDPTTFVPRASEILIGLGFTSQTMLKKTKDLSGGWRMRVSLAKALFIKPTLLLLDEPTNHLDLGACVWLEDYLANYDRSLIIISHSQDFLNAVCTNIIHMTQSKLKYYGGNYDNF 282          
BLAST of CX287042 vs. ExPASy Swiss-Prot
Match: Y658_HAEIN (Uncharacterized ABC transporter ATP-binding protein HI0658 OS=Haemophilus influenzae GN=HI0658 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.424e-17
Identity = 47/118 (39.83%), Postives = 69/118 (58.47%), Query Frame = 2
Query:  176 LDTLDA-----KVSKLMPELGFTADDGDRLVASFSSGWQMRMSLGKIXXXXXXXXXXXEPTNHLDLDTIEWLEGYLGKQDVPMVIISHDRAFLDQLCTKIVETEMGVSRTYEGNYSQY 514
            L+TLDA     + + L+  LGF+ ++  + V +FS GW+MR++L +            EPTNHLDLD + WLE +L +    +V+ISHDR FLD + TKI+  E      Y G+YS +
Sbjct:  117 LETLDAWTIQSRAASLLHGLGFSQEETIQPVKAFSGGWRMRLNLAQALLCPSDLLLLDEPTNHLDLDAVIWLERWLVQYQGTLVLISHDRDFLDPIVTKILHIENQKLNEYTGDYSSF 234          
BLAST of CX287042 vs. ExPASy Swiss-Prot
Match: ABCF1_PIG (ATP-binding cassette sub-family F member 1 OS=Sus scrofa GN=ABCF1 PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.429e-17
Identity = 48/162 (29.63%), Postives = 78/162 (48.15%), Query Frame = 2
Query:   29 MSAFKEEMEIAGKLERVQKALESAVDDMDLMGRLLDEFDLLQRKAQAVNLDTLDAKVSKLMPELGFTADDGDRLVASFSSGWQMRMSLGKIXXXXXXXXXXXEPTNHLDLDTIEWLEGYLGKQDVPMVIISHDRAFLDQLCTKIVETEMGVSRTYEGNYSQY 514
            + A  + +++  +  R+Q  LE   D         D  + +  + +A      +AK  +++  LGF  +  +R    FS GW+MR+SL +            EPTNHLDL+ + WL  YL      ++I+SHD+ FLD +CT I+  +      Y GNY  +
Sbjct:  343 LRADTKRLKLLEEERRLQGQLEQGDDTA------ADRLEKVYEELRATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDAQRLHYYRGNYMTF 498          
The following BLAST results are available for this feature:
BLAST of CX287042 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 51
Match NameE-valueIdentityDescription
AB5F_ARATH5.145e-7681.87ABC transporter F family member 5 OS=Arabidopsis t... [more]
AB2F_ARATH2.921e-7177.19ABC transporter F family member 2 OS=Arabidopsis t... [more]
AB4F_ARATH1.376e-2034.91ABC transporter F family member 4 OS=Arabidopsis t... [more]
YDIF_BACSU3.066e-2031.55Uncharacterized ABC transporter ATP-binding protei... [more]
UUP_ECOLI1.288e-1835.94ABC transporter ATP-binding protein uup OS=Escheri... [more]
YHES_ECOLI3.747e-1836.97Uncharacterized ABC transporter ATP-binding protei... [more]
YHES_ECO573.747e-1836.97Uncharacterized ABC transporter ATP-binding protei... [more]
ABCF2_DICDI1.090e-1735.40ABC transporter F family member 2 OS=Dictyostelium... [more]
Y658_HAEIN1.424e-1739.83Uncharacterized ABC transporter ATP-binding protei... [more]
ABCF1_PIG2.429e-1729.63ATP-binding cassette sub-family F member 1 OS=Sus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01003H10SK Veg1 Citrus clementina cDNA clone C01003H10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287042 ID=CX287042; Name=CX287042; organism=Citrus clementina; type=EST; length=516bp
AATGAGCAGAACGGTAAGAGAAGAGTTTATGAGTGCGTTTAAAGAGGAAA
TGGAGATTGCTGGGAAGTTGGAGAGAGTGCAAAAGGCTTTAGAAAGTGCT
GTTGATGATATGGATTTGATGGGGAGACTTTTGGATGAGTTTGATTTGTT
GCAGAGGAAAGCACAGGCTGTGAATTTGGATACGTTGGATGCTAAGGTTA
GTAAGTTGATGCCGGAGCTAGGATTTACGGCTGACGATGGAGATAGGTTG
GTGGCATCGTTTAGTAGTGGGTGGCAGATGAGAATGTCGCTCGGGAAGAT
TTTGTTGCAGGATCCAGATTTATTGCTTCTGGATGAGCCTACAAATCACC
TTGATCTTGACACAATTGAGTGGCTTGAAGGTTATCTCGGCAAGCAAGAT
GTGCCAATGGTTATCATATCTCACGACAGAGCTTTTCTTGATCAGCTGTG
TACTAAAATTGTGGAAACTGAAATGGGTGTGTCCAGGACGTACGAGGGAA
ATTATTCTCAGTACGT
back to top