CX287050

Overview
NameCX287050
Unique NameCX287050
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length409
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14388 contig Ccv1_Contig14388:93..501. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287050 vs. ExPASy Swiss-Prot
Match: MGST3_MOUSE (Microsomal glutathione S-transferase 3 OS=Mus musculus GN=Mgst3 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.371e-19
Identity = 46/107 (42.99%), Postives = 62/107 (57.94%), Query Frame = 2
Query:   89 LPTEYGYVALVLVFYCFLNFWMGFQVGAARKKYKVPYPTLYAVESENKEAKLFNCVQRGHQNSLELMPVFFMLMIVGGLKHPCVCAVLGSLFTVTRFFYFKGYATGD 409
            L  EYG+V L       +   +   VG ARKKYKV YP +Y+ + EN    +FNC+QR HQN+LE+ P F   + VGG+ HP + + LG  + + R  Y  GY TGD
Sbjct:    4 LSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPEN--GHMFNCIQRAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIIGRVLYAYGYYTGD 108          
BLAST of CX287050 vs. ExPASy Swiss-Prot
Match: MGST3_BOVIN (Microsomal glutathione S-transferase 3 OS=Bos taurus GN=MGST3 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.673e-18
Identity = 46/107 (42.99%), Postives = 62/107 (57.94%), Query Frame = 2
Query:   89 LPTEYGYVALVLVFYCFLNFWMGFQVGAARKKYKVPYPTLYAVESENKEAKLFNCVQRGHQNSLELMPVFFMLMIVGGLKHPCVCAVLGSLFTVTRFFYFKGYATGD 409
            L  EYG+V L       +   +   V  ARKKYKV YPT+Y+ + EN    +FNC+QR HQN+LE+ P F   + VGG+ HP + + LG  + V R  Y  GY TG+
Sbjct:    4 LSKEYGFVILTGAASFLMVTHLAINVSKARKKYKVEYPTMYSTDPEN--GHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGE 108          
BLAST of CX287050 vs. ExPASy Swiss-Prot
Match: MGST3_HUMAN (Microsomal glutathione S-transferase 3 OS=Homo sapiens GN=MGST3 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.358e-18
Identity = 45/107 (42.06%), Postives = 61/107 (57.01%), Query Frame = 2
Query:   89 LPTEYGYVALVLVFYCFLNFWMGFQVGAARKKYKVPYPTLYAVESENKEAKLFNCVQRGHQNSLELMPVFFMLMIVGGLKHPCVCAVLGSLFTVTRFFYFKGYATGD 409
            L  EYG+V L       +   +   V  ARKKYKV YP +Y+ + EN    +FNC+QR HQN+LE+ P F   + VGG+ HP + + LG  + V R  Y  GY TG+
Sbjct:    4 LSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPEN--GHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGE 108          
The following BLAST results are available for this feature:
BLAST of CX287050 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
MGST3_MOUSE3.371e-1942.99Microsomal glutathione S-transferase 3 OS=Mus musc... [more]
MGST3_BOVIN1.673e-1842.99Microsomal glutathione S-transferase 3 OS=Bos taur... [more]
MGST3_HUMAN6.358e-1842.06Microsomal glutathione S-transferase 3 OS=Homo sap... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01004A10SK Veg1 Citrus clementina cDNA clone C01004A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287050 ID=CX287050; Name=CX287050; organism=Citrus clementina; type=EST; length=409bp
CTATTTCATATCGTTAGTTGGTCAACGTTGTCTCTTGGGTGAGATGTTTT
CATCGATCGACTCGACTGTGGCGGCTGCAACTCAATTTCTACCAACAGAA
TACGGATATGTGGCTCTTGTTCTTGTTTTCTACTGCTTTCTCAATTTCTG
GATGGGTTTTCAAGTCGGAGCTGCCCGCAAGAAGTATAAGGTGCCCTATC
CTACCCTCTACGCTGTAGAATCTGAGAACAAAGAAGCTAAGCTCTTTAAC
TGCGTTCAGAGAGGGCATCAGAACTCTTTGGAACTTATGCCGGTGTTTTT
CATGTTGATGATAGTCGGAGGGCTAAAGCATCCATGTGTTTGTGCCGTAC
TCGGATCCCTTTTCACTGTCACTCGTTTTTTCTACTTCAAAGGCTATGCT
ACTGGCGAT
back to top