CX287061
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB23_ORYSJ (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. japonica GN=RCABP89 PE=2 SV=1) HSP 1 Score: 117.472 bits (293), Expect = 2.178e-26 Identity = 53/54 (98.15%), Postives = 54/54 (100.00%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGA Sbjct: 54 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA 107
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB23_ORYSI (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_012078 PE=2 SV=1) HSP 1 Score: 117.472 bits (293), Expect = 2.178e-26 Identity = 53/54 (98.15%), Postives = 54/54 (100.00%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGA Sbjct: 54 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA 107
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB21_LEMGI (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Lemna gibba PE=3 SV=1) HSP 1 Score: 117.087 bits (292), Expect = 2.844e-26 Identity = 53/54 (98.15%), Postives = 54/54 (100.00%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 K+LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA Sbjct: 55 KFLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 108
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB21_SILPR (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Silene pratensis PE=2 SV=2) HSP 1 Score: 116.701 bits (291), Expect = 3.715e-26 Identity = 53/54 (98.15%), Postives = 53/54 (98.15%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGA Sbjct: 55 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGA 108
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB26_PETSP (Chlorophyll a-b binding protein 37, chloroplastic OS=Petunia sp. GN=CAB37 PE=3 SV=1) HSP 1 Score: 115.546 bits (288), Expect = 8.276e-26 Identity = 52/54 (96.30%), Postives = 53/54 (98.15%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGA Sbjct: 56 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGA 109
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB25_SOLLC (Chlorophyll a-b binding protein 5, chloroplastic (Fragment) OS=Solanum lycopersicum GN=CAB5 PE=2 SV=1) HSP 1 Score: 115.546 bits (288), Expect = 8.276e-26 Identity = 52/54 (96.30%), Postives = 53/54 (98.15%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGA Sbjct: 28 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGA 81
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB24_SOLLC (Chlorophyll a-b binding protein 4, chloroplastic OS=Solanum lycopersicum GN=CAB4 PE=2 SV=1) HSP 1 Score: 115.546 bits (288), Expect = 8.276e-26 Identity = 52/54 (96.30%), Postives = 53/54 (98.15%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGA Sbjct: 56 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGA 109
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB23_TOBAC (Chlorophyll a-b binding protein 36, chloroplastic OS=Nicotiana tabacum GN=CAB36 PE=3 SV=1) HSP 1 Score: 115.546 bits (288), Expect = 8.276e-26 Identity = 52/54 (96.30%), Postives = 53/54 (98.15%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGA Sbjct: 56 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGA 109
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB215_PEA (Chlorophyll a-b binding protein 215, chloroplastic OS=Pisum sativum GN=CAB215 PE=1 SV=1) HSP 1 Score: 115.161 bits (287), Expect = 1.081e-25 Identity = 52/54 (96.30%), Postives = 53/54 (98.15%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFSEQ PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGA Sbjct: 56 KYLGPFSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA 109
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB21_PEA (Chlorophyll a-b binding protein AB96 (Fragment) OS=Pisum sativum GN=AB96 PE=1 SV=1) HSP 1 Score: 113.235 bits (282), Expect = 4.107e-25 Identity = 51/54 (94.44%), Postives = 53/54 (98.15%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFS ++PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA Sbjct: 19 KYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 72 The following BLAST results are available for this feature:
BLAST of CX287061 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 58
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX287061 ID=CX287061; Name=CX287061; organism=Citrus clementina; type=EST; length=165bpback to top |