CX287063

Overview
NameCX287063
Unique NameCX287063
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length320
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10231 contig Ccv1_Contig10231:1189..1508. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287063 vs. ExPASy Swiss-Prot
Match: HSP7M_PEA (Heat shock 70 kDa protein, mitochondrial OS=Pisum sativum GN=HSP1 PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 3.056e-49
Identity = 99/106 (93.40%), Postives = 104/106 (98.11%), Query Frame = 1
Query:    1 DANITTKDVDEVLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTISTKKSQVFSTAAD 318
            DANI+ KDVDEVLLVGGMTRVPKVQ+VVSEIFGKSPSKGVNPDEAVA+GAA+QGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLI+RNTTI TKKSQVFSTAAD
Sbjct:  370 DANISIKDVDEVLLVGGMTRVPKVQQVVSEIFGKSPSKGVNPDEAVAMGAALQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLISRNTTIPTKKSQVFSTAAD 475          
BLAST of CX287063 vs. ExPASy Swiss-Prot
Match: HSP7M_PHAVU (Heat shock 70 kDa protein, mitochondrial OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 5.213e-49
Identity = 99/106 (93.40%), Postives = 102/106 (96.23%), Query Frame = 1
Query:    1 DANITTKDVDEVLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTISTKKSQVFSTAAD 318
            DAN++ KDVDEVLLVGGMTRVPKVQEVV  IFGKSPSKGVNPDEAVA+GAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTI TKKSQVFSTAAD
Sbjct:  369 DANVSIKDVDEVLLVGGMTRVPKVQEVVLNIFGKSPSKGVNPDEAVAMGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAAD 474          
BLAST of CX287063 vs. ExPASy Swiss-Prot
Match: HSP7M_SOLTU (Heat shock 70 kDa protein, mitochondrial OS=Solanum tuberosum GN=HSP68 PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 3.379e-48
Identity = 96/106 (90.57%), Postives = 102/106 (96.23%), Query Frame = 1
Query:    1 DANITTKDVDEVLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTISTKKSQVFSTAAD 318
            DA ++ KDVDEVLLVGGMTRVPKVQE+VSEIFGKSPSKGVNPDEAVA+GAA+QGGILRGDVKELLLLDVTPL+ GIETLGGIFTRLINRNTTI TKKSQVFSTAAD
Sbjct:  375 DAGVSLKDVDEVLLVGGMTRVPKVQEIVSEIFGKSPSKGVNPDEAVAMGAALQGGILRGDVKELLLLDVTPLARGIETLGGIFTRLINRNTTIPTKKSQVFSTAAD 480          
BLAST of CX287063 vs. ExPASy Swiss-Prot
Match: DNAK_AGRVS (Chaperone protein dnaK OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaK PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 2.770e-42
Identity = 82/106 (77.36%), Postives = 96/106 (90.57%), Query Frame = 1
Query:    1 DANITTKDVDEVLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTISTKKSQVFSTAAD 318
            DA +T  D+DEV+LVGGM+R+PKVQEVV ++FGK P KGVNPDE VA+GAAIQ G+L+GDVK++LLLDVTPLSLGIETLGG+FTRLI+RNTTI TKKSQVFSTA D
Sbjct:  321 DAGVTAADIDEVVLVGGMSRMPKVQEVVKQLFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQVFSTADD 426          
BLAST of CX287063 vs. ExPASy Swiss-Prot
Match: GRP75_PONAB (Stress-70 protein, mitochondrial OS=Pongo abelii GN=HSPA9 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.375e-41
Identity = 80/106 (75.47%), Postives = 96/106 (90.57%), Query Frame = 1
Query:    1 DANITTKDVDEVLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTISTKKSQVFSTAAD 318
            DA ++  D+ EV+LVGGMTR+PKVQ+ V ++FG++PSK VNPDEAVA+GAAIQGG+L GDV ++LLLDVTPLSLGIETLGG+FT+LINRNTTI TKKSQVFSTAAD
Sbjct:  372 DAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAAD 477          
BLAST of CX287063 vs. ExPASy Swiss-Prot
Match: GRP75_MOUSE (Stress-70 protein, mitochondrial OS=Mus musculus GN=Hspa9 PE=1 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 1.375e-41
Identity = 80/106 (75.47%), Postives = 96/106 (90.57%), Query Frame = 1
Query:    1 DANITTKDVDEVLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTISTKKSQVFSTAAD 318
            DA ++  D+ EV+LVGGMTR+PKVQ+ V ++FG++PSK VNPDEAVA+GAAIQGG+L GDV ++LLLDVTPLSLGIETLGG+FT+LINRNTTI TKKSQVFSTAAD
Sbjct:  372 DAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAAD 477          
BLAST of CX287063 vs. ExPASy Swiss-Prot
Match: GRP75_HUMAN (Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 1.375e-41
Identity = 80/106 (75.47%), Postives = 96/106 (90.57%), Query Frame = 1
Query:    1 DANITTKDVDEVLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTISTKKSQVFSTAAD 318
            DA ++  D+ EV+LVGGMTR+PKVQ+ V ++FG++PSK VNPDEAVA+GAAIQGG+L GDV ++LLLDVTPLSLGIETLGG+FT+LINRNTTI TKKSQVFSTAAD
Sbjct:  372 DAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAAD 477          
BLAST of CX287063 vs. ExPASy Swiss-Prot
Match: GRP75_CRIGR (Stress-70 protein, mitochondrial OS=Cricetulus griseus GN=HSPA9 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.375e-41
Identity = 80/106 (75.47%), Postives = 96/106 (90.57%), Query Frame = 1
Query:    1 DANITTKDVDEVLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTISTKKSQVFSTAAD 318
            DA ++  D+ EV+LVGGMTR+PKVQ+ V ++FG++PSK VNPDEAVA+GAAIQGG+L GDV ++LLLDVTPLSLGIETLGG+FT+LINRNTTI TKKSQVFSTAAD
Sbjct:  372 DAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAAD 477          
BLAST of CX287063 vs. ExPASy Swiss-Prot
Match: GRP75_CHICK (Stress-70 protein, mitochondrial OS=Gallus gallus GN=HSPA9 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.375e-41
Identity = 80/106 (75.47%), Postives = 96/106 (90.57%), Query Frame = 1
Query:    1 DANITTKDVDEVLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTISTKKSQVFSTAAD 318
            DA ++  D+ EV+LVGGMTR+PKVQ+ V ++FG++PSK VNPDEAVA+GAAIQGG+L GDV ++LLLDVTPLSLGIETLGG+FT+LINRNTTI TKKSQVFSTAAD
Sbjct:  374 DAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAAD 479          
BLAST of CX287063 vs. ExPASy Swiss-Prot
Match: GRP75_BOVIN (Stress-70 protein, mitochondrial OS=Bos taurus GN=HSPA9 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.375e-41
Identity = 80/106 (75.47%), Postives = 96/106 (90.57%), Query Frame = 1
Query:    1 DANITTKDVDEVLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTISTKKSQVFSTAAD 318
            DA ++  D+ EV+LVGGMTR+PKVQ+ V ++FG++PSK VNPDEAVA+GAAIQGG+L GDV ++LLLDVTPLSLGIETLGG+FT+LINRNTTI TKKSQVFSTAAD
Sbjct:  372 DAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAAD 477          
The following BLAST results are available for this feature:
BLAST of CX287063 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP7M_PEA3.056e-4993.40Heat shock 70 kDa protein, mitochondrial OS=Pisum ... [more]
HSP7M_PHAVU5.213e-4993.40Heat shock 70 kDa protein, mitochondrial OS=Phaseo... [more]
HSP7M_SOLTU3.379e-4890.57Heat shock 70 kDa protein, mitochondrial OS=Solanu... [more]
DNAK_AGRVS2.770e-4277.36Chaperone protein dnaK OS=Agrobacterium vitis (str... [more]
GRP75_PONAB1.375e-4175.47Stress-70 protein, mitochondrial OS=Pongo abelii G... [more]
GRP75_MOUSE1.375e-4175.47Stress-70 protein, mitochondrial OS=Mus musculus G... [more]
GRP75_HUMAN1.375e-4175.47Stress-70 protein, mitochondrial OS=Homo sapiens G... [more]
GRP75_CRIGR1.375e-4175.47Stress-70 protein, mitochondrial OS=Cricetulus gri... [more]
GRP75_CHICK1.375e-4175.47Stress-70 protein, mitochondrial OS=Gallus gallus ... [more]
GRP75_BOVIN1.375e-4175.47Stress-70 protein, mitochondrial OS=Bos taurus GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01004C06SK Veg1 Citrus clementina cDNA clone C01004C06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287063 ID=CX287063|Name=CX287063|organism=Citrus clementina|type=EST|length=320bp
GATGCCAACATTACCACAAAGGATGTGGATGAGGTGCTTTTGGTTGGAGG
AATGACCCGTGTGCCAAAGGTGCAGGAAGTGGTCTCAGAAATCTTTGGTA
AGAGTCCAAGCAAGGGAGTAAATCCTGATGAGGCAGTTGCCCTTGGTGCT
GCTATTCAAGGTGGTATTCTTCGTGGCGACGTCAAAGAGTTGCTTCTCTT
GGATGTTACACCTCTGTCACTGGGTATTGAGACACTAGGTGGTATCTTTA
CCAGGTTGATCAATCGCAACACAACTATTTCAACAAAAAAGAGTCAGGTC
TTCTCAACAGCAGCTGATAA
back to top