CX287064

Overview
NameCX287064
Unique NameCX287064
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length540
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig26 contig Ccv1_Contig26:1..540. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287064 vs. ExPASy Swiss-Prot
Match: RUBB_BRANA (RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 2.453e-42
Identity = 95/141 (67.38%), Postives = 105/141 (74.47%), Query Frame = 1
Query:  124 MASTFTAMSSISSMIAPNGRMTDXXXXXXXXXXXXXXXXXXXXFGRRQSV--ALRRARTPKIYAAKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQA 540
            MASTFTA SSI SM+APN   TD                    FGRRQ+V   LRR+    + AAK+LHFNKDG  ++KLQ GVNKLADLVGVTLGPKGRNVVLESKYG+P+IVNDGVTVA+EVELEDPVENIGAKLVRQA
Sbjct:    1 MASTFTATSSIGSMVAPNAHKTDKKLMNKLSSSS---------FGRRQNVFPKLRRSSPAVVCAAKELHFNKDGTTIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREVELEDPVENIGAKLVRQA 132          
BLAST of CX287064 vs. ExPASy Swiss-Prot
Match: RUBB_ARATH (RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Arabidopsis thaliana GN=At1g55490 PE=1 SV=3)

HSP 1 Score: 170.244 bits (430), Expect = 5.465e-42
Identity = 94/141 (66.67%), Postives = 105/141 (74.47%), Query Frame = 1
Query:  124 MASTFTAMSSISSMIAPNGRMTDXXXXXXXXXXXXXXXXXXXXFGRRQSVALRRARTPK--IYAAKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQA 540
            MASTFTA SSI SM+APNG  +D                    FGRRQSV  R  R+    + AAK+LHFNKDG  +++LQ GVNKLADLVGVTLGPKGRNVVLESKYG+P+IVNDGVTVA+EVELEDPVENIGAKLVRQA
Sbjct:    1 MASTFTATSSIGSMVAPNGHKSDKKLISKLSSSS---------FGRRQSVCPRPRRSSSAIVCAAKELHFNKDGTTIRRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREVELEDPVENIGAKLVRQA 132          
BLAST of CX287064 vs. ExPASy Swiss-Prot
Match: RUBB_PEA (RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 1.304e-35
Identity = 77/88 (87.50%), Postives = 82/88 (93.18%), Query Frame = 1
Query:  280 RRARTPKIYA-AKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQA 540
            R+ R  K+ A AK+LHFNKDG A+KKLQNGVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVAKEVELEDPVENIGAKLVRQA
Sbjct:   39 RKNRNVKVSAMAKELHFNKDGSAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRQA 126          
BLAST of CX287064 vs. ExPASy Swiss-Prot
Match: CH60_CALS8 (60 kDa chaperonin OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903) GN=groL PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 6.282e-22
Identity = 51/77 (66.23%), Postives = 66/77 (85.71%), Query Frame = 1
Query:  307 AAKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQ 537
            AAK + F+++  A + L+ GVNKLAD V VTLGPKGRNVVLE K+G+P+IVNDGVT+AKE+ELEDP EN+GA++VR+
Sbjct:    2 AAKMILFDEE--ARRALERGVNKLADTVKVTLGPKGRNVVLEKKFGSPQIVNDGVTIAKEIELEDPFENMGAQIVRE 76          
BLAST of CX287064 vs. ExPASy Swiss-Prot
Match: CH60_ANATD (60 kDa chaperonin OS=Anaerocellum thermophilum (strain DSM 6725 / Z-1320) GN=groL PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 6.282e-22
Identity = 51/77 (66.23%), Postives = 66/77 (85.71%), Query Frame = 1
Query:  307 AAKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQ 537
            AAK + F+++  A + L+ GVNKLAD V VTLGPKGRNVVLE K+G+P+IVNDGVT+AKE+ELEDP EN+GA++VR+
Sbjct:    2 AAKMILFDEE--ARRALERGVNKLADTVKVTLGPKGRNVVLEKKFGSPQIVNDGVTIAKEIELEDPFENMGAQIVRE 76          
BLAST of CX287064 vs. ExPASy Swiss-Prot
Match: CH602_GLOVI (60 kDa chaperonin 2 OS=Gloeobacter violaceus GN=groL2 PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 3.118e-21
Identity = 48/68 (70.59%), Postives = 58/68 (85.29%), Query Frame = 1
Query:  334 DGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQ 537
            D  A + L+ GVN LAD V VTLGPKGRNVVLE K+GAP+IVNDGVT+AKE+ELEDP+EN GA+L+R+
Sbjct:    8 DETARRALERGVNALADAVRVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELEDPLENTGAQLIRE 75          
BLAST of CX287064 vs. ExPASy Swiss-Prot
Match: CH60_LACDB (60 kDa chaperonin OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=groL PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.072e-21
Identity = 52/77 (67.53%), Postives = 60/77 (77.92%), Query Frame = 1
Query:  310 AKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQA 540
            AKD+ F++D  A + L NGVNKLA+ V  TLGPKGRNVVLE  YGAP I NDGVT+AK +ELED  ENIGAKLV +A
Sbjct:    2 AKDIKFSED--ARRSLLNGVNKLANTVKTTLGPKGRNVVLEQSYGAPTITNDGVTIAKAIELEDHYENIGAKLVAEA 76          
BLAST of CX287064 vs. ExPASy Swiss-Prot
Match: CH60_LACDA (60 kDa chaperonin OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081) GN=groL PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.072e-21
Identity = 52/77 (67.53%), Postives = 60/77 (77.92%), Query Frame = 1
Query:  310 AKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQA 540
            AKD+ F++D  A + L NGVNKLA+ V  TLGPKGRNVVLE  YGAP I NDGVT+AK +ELED  ENIGAKLV +A
Sbjct:    2 AKDIKFSED--ARRSLLNGVNKLANTVKTTLGPKGRNVVLEQSYGAPTITNDGVTIAKAIELEDHYENIGAKLVAEA 76          
BLAST of CX287064 vs. ExPASy Swiss-Prot
Match: CH60_CHLT3 (60 kDa chaperonin OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=groL PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.072e-21
Identity = 48/77 (62.34%), Postives = 63/77 (81.82%), Query Frame = 1
Query:  307 AAKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQ 537
            AAK++HF+ +G     L+ GV+KLAD V VTLGP GRNV+++ K+GAP +  DGVTVAKEVELEDPVEN+GA++VR+
Sbjct:    2 AAKEIHFDAEG--RNALKRGVDKLADAVKVTLGPAGRNVIIDKKFGAPTVTKDGVTVAKEVELEDPVENMGAQMVRE 76          
BLAST of CX287064 vs. ExPASy Swiss-Prot
Match: CH60_FUSNP (60 kDa chaperonin OS=Fusobacterium nucleatum subsp. polymorphum GN=groL PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 5.318e-21
Identity = 51/76 (67.11%), Postives = 61/76 (80.26%), Query Frame = 1
Query:  310 AKDLHFNKDGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQ 537
            AK ++FN +  A KKL+ GVN LAD V VTLGP+GRNVVLE  YGAP I NDGVT+AKE+ELEDP EN+GA LV++
Sbjct:    2 AKIINFNDE--ARKKLEIGVNTLADAVKVTLGPRGRNVVLEKSYGAPLITNDGVTIAKEIELEDPFENMGAALVKE 75          
The following BLAST results are available for this feature:
BLAST of CX287064 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RUBB_BRANA2.453e-4267.38RuBisCO large subunit-binding protein subunit beta... [more]
RUBB_ARATH5.465e-4266.67RuBisCO large subunit-binding protein subunit beta... [more]
RUBB_PEA1.304e-3587.50RuBisCO large subunit-binding protein subunit beta... [more]
CH60_CALS86.282e-2266.2360 kDa chaperonin OS=Caldicellulosiruptor saccharo... [more]
CH60_ANATD6.282e-2266.2360 kDa chaperonin OS=Anaerocellum thermophilum (st... [more]
CH602_GLOVI3.118e-2170.5960 kDa chaperonin 2 OS=Gloeobacter violaceus GN=gr... [more]
CH60_LACDB4.072e-2167.5360 kDa chaperonin OS=Lactobacillus delbrueckii sub... [more]
CH60_LACDA4.072e-2167.5360 kDa chaperonin OS=Lactobacillus delbrueckii sub... [more]
CH60_CHLT34.072e-2162.3460 kDa chaperonin OS=Chloroherpeton thalassium (st... [more]
CH60_FUSNP5.318e-2167.1160 kDa chaperonin OS=Fusobacterium nucleatum subsp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01004C07SK Veg1 Citrus clementina cDNA clone C01004C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287064 ID=CX287064|Name=CX287064|organism=Citrus clementina|type=EST|length=540bp
GGGCCCTTTATATTATCAACAAAAGCCACCAACTCTCAGCTCCTACTCTG
CCTGCAGCTCCCCTTATCTCTTTAAACCCTAAAACTCTCGCACTTTCCGC
CGTCTCACAGTTTAAACGAATAAATGGCGTCGACTTTCACTGCCATGTCT
TCCATTAGCTCCATGATTGCTCCTAATGGACGAATGACTGATAAGAAGCT
TGCATCTTCTTCGAACAAATTGTCATCACTTGCTTCCATTTCTTCAAGTT
CATTCGGCAGGAGACAGAGTGTAGCTCTACGCAGGGCCCGCACACCTAAG
ATTTATGCGGCAAAGGACTTGCATTTCAACAAGGATGGATATGCCATGAA
GAAACTTCAAAATGGTGTCAACAAGCTTGCAGATCTAGTTGGAGTTACCC
TTGGTCCCAAGGGCAGGAATGTTGTTCTAGAGAGCAAGTACGGTGCCCCA
AAAATTGTGAATGATGGTGTAACTGTGGCCAAAGAAGTTGAGTTAGAGGA
CCCGGTTGAGAACATTGGTGCTAAATTAGTGAGACAAGCA
back to top