CX287068

Overview
NameCX287068
Unique NameCX287068
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length581
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig5982 contig Ccv1_Contig5982:297..877. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287068 vs. ExPASy Swiss-Prot
Match: C90A1_ARATH (Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CYP90A1 PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 1.964e-75
Identity = 134/156 (85.90%), Postives = 146/156 (93.59%), Query Frame = 3
Query:  114 ETLQLIAAYKTENPEPFIDVRVKRFGSIFTTHIFGEPTVFSADPETNRFILQNEGKLFECSYPGSISNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIRDHLLVDIDRLVRLHMDSWTDRVLLMEEAKKITFELTVKQLMSFDPNEWTESLRKEY 581
            ET QLI AYKTENPEPFID RV R+GS+F TH+FGEPT+FSADPETNRF+LQNEGKLFECSYP SI NLLGKHSLLLMKGSLHKRMHSLTMSFANSSII+DHL++DIDRLVR ++DSW+ RVLLMEEAKKITFELTVKQLMSFDP EW+ESLRKEY
Sbjct:   43 ETFQLIGAYKTENPEPFIDERVARYGSVFMTHLFGEPTIFSADPETNRFVLQNEGKLFECSYPASICNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIKDHLMLDIDRLVRFNLDSWSSRVLLMEEAKKITFELTVKQLMSFDPGEWSESLRKEY 198          
BLAST of CX287068 vs. ExPASy Swiss-Prot
Match: C90B1_ARATH (Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CYP90B1 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.574e-32
Identity = 70/159 (44.03%), Postives = 101/159 (63.52%), Query Frame = 3
Query:  114 ETLQLIAAYKTENPEPFIDVRVKRFGSIFTTHIFGEPTVFSADPETNRFILQNEGKLFECSYPGSISNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIRDHLLVDIDRLVRLHMDSWTDRVLL--MEEAKKITFELTVKQLMSFDP-NEWTESLRKEY 581
            ET+  +  Y       F+   V ++G I+ +++FGEPT+ SAD   NRFILQNEG+LFECSYP SI  +LGK S+L++ G +H+ M S++++F + + +R  LL D++R     +DSW    +    +EAKK TF L  K +MS DP  E TE L+KEY
Sbjct:   51 ETIGYLKPYTATTLGDFMQQHVSKYGKIYRSNLFGEPTIVSADAGLNRFILQNEGRLFECSYPRSIGGILGKWSMLVLVGDMHRDMRSISLNFLSHARLRTILLKDVERHTLFVLDSWQQNSIFSAQDEAKKFTFNLMAKHIMSMDPGEEETEQLKKEY 209          
BLAST of CX287068 vs. ExPASy Swiss-Prot
Match: C90C1_ARATH (Cytochrome P450 90C1 OS=Arabidopsis thaliana GN=ROT3 PE=2 SV=3)

HSP 1 Score: 115.546 bits (288), Expect = 1.864e-25
Identity = 63/158 (39.87%), Postives = 91/158 (57.59%), Query Frame = 3
Query:  114 ETLQLIAAYKTENPEPFIDVRVKRFGSIFTTHIFGEPTVFSADPETNRFILQNEGKLFECSYPGSISNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIRDHLLVDIDRLVRLHMDSWTDRVL--LMEEAKKITFELTVKQLMSFDPNEWTESLRKEY 581
            ETL  IA   +  P  F+D R   +G +F T+I G P + S D E N+ +LQN G  F  +YP SI+ LLG++S+L + G   KR+H+L  +F  S  ++D +  DI+  V L + SW    L  + +E KK+TFE+ VK LMS  P E    L+ E+
Sbjct:   81 ETLNFIACGYSSRPVTFMDKRKSLYGKVFKTNIIGTPIIISTDAEVNKVVLQNHGNTFVPAYPKSITELLGENSILSINGPHQKRLHTLIGAFLRSPHLKDRITRDIEASVVLTLASWAQLPLVHVQDEIKKMTFEILVKVLMSTSPGEDMNILKLEF 238          
BLAST of CX287068 vs. ExPASy Swiss-Prot
Match: C724B_ORYSJ (Cytochrome P450 724B1 OS=Oryza sativa subsp. japonica GN=CYP724B1 PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 7.830e-24
Identity = 54/156 (34.62%), Postives = 89/156 (57.05%), Query Frame = 3
Query:  114 ETLQLIAAYKTENPEPFIDVRVKRFGSIFTTHIFGEPTVFSADPETNRFILQNEGKLFECSYPGSISNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIRDHLLVDIDRLVRLHMDSWTDR---------VLLMEEAKKITFELTVKQLMSFDPNE 554
            ETL+ ++ + +     F++    R+G +F +H+F  PT+ S D E N FILQNE +LF+CSYP  I  +LGK S+L++ G  HKR+ +L ++   S+ ++   L DI+++    + SW  +         +   EEA+K  F + VKQ++   P E
Sbjct:   47 ETLRFLSPHASNTLGSFLEDHCSRYGRVFKSHLFCTPTIVSCDQELNHFILQNEERLFQCSYPRPIHGILGKSSMLVVLGEDHKRLRNLALALVTSTKLKPSYLGDIEKIALHIVGSWHGKSKDKGMVNVIAFCEEARKFAFSVIVKQVLGLSPEE 202          
BLAST of CX287068 vs. ExPASy Swiss-Prot
Match: C90D2_ORYSJ (Cytochrome P450 90D2 OS=Oryza sativa subsp. japonica GN=CYP90D2 PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.278e-23
Identity = 57/159 (35.85%), Postives = 97/159 (61.01%), Query Frame = 3
Query:  114 ETLQLIAAYKTENPEPFIDVRVKRFGS-IFTTHIFGEPTVFSADPETNRFILQNEGKLFECSYPGSISNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIRDHLLVDIDRLVRLHMDSWTDRVLLMEE--AKKITFELTVKQLMSFDPNEWTESLRKEY 581
            ETL+ ++   +  PE F+D R K  GS +F +H+FG  TV +AD E +RF+LQ++ + F   YP S++ L+GK S+LL+ G+L +R+H L  +F  SS ++  L  D+ R +   + S+ D  LL  +  AK + FE+ V+ L+  +  E  + L++++
Sbjct:   61 ETLEFVSCAYSPRPEAFVDKRRKLHGSAVFRSHLFGSATVVTADAEVSRFVLQSDARAFVPWYPRSLTELMGKSSILLINGALQRRVHGLVGAFFKSSHLKSQLTADMRRRLSPALSSFPDSSLLHVQHLAKSVVFEILVRGLIGLEAGEEMQQLKQQF 219          
BLAST of CX287068 vs. ExPASy Swiss-Prot
Match: C87A3_ORYSJ (Cytochrome P450 87A3 OS=Oryza sativa subsp. japonica GN=CYP87A3 PE=2 SV=3)

HSP 1 Score: 107.071 bits (266), Expect = 6.628e-23
Identity = 57/159 (35.85%), Postives = 92/159 (57.86%), Query Frame = 3
Query:  114 ETLQLIAAYKTENPEPFIDVRVKRFGSIFTTHIFGEPTVFSADPETNRFILQNEGKLFECSYPGSISNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIRDHLLVDIDRLVRLHMDSWTDR--VLLMEEAKKITFELTVKQLMSFDPNEWTE-SLRKEY 581
            ETLQ  A   T +  PF+  R+KR+GSIF T + G P V SADPE N ++ Q EGKLFE  YP + + + G+ ++  + G ++K + +L +       ++  LL + D   R  + SW  +  V L E    + F+LT K+L+ +DP++ ++ +LRK +
Sbjct:   83 ETLQFFAPNPTCDLSPFVKERIKRYGSIFKTSVVGRPVVVSADPEMNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKTLVLRLYGQENLKSVLLAETDAACRGSLASWASQPSVELKEGISTMIFDLTAKKLIGYDPSKPSQVNLRKNF 241          
BLAST of CX287068 vs. ExPASy Swiss-Prot
Match: C72B1_PINTA (Abietadienol/abietadienal oxidase OS=Pinus taeda GN=CYP720B1 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.250e-21
Identity = 48/155 (30.97%), Postives = 85/155 (54.84%), Query Frame = 3
Query:  114 ETLQLIAAYKTENPEPFIDVRVKRFGS-IFTTHIFGEPTVFSADPETNRFILQNEGKLFECSYPGSISNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIRDHLLVDIDRLVRLHMDSWTDR--VLLMEEAKKITFELTVKQLMSFDPNEWTESL 569
            ET     +  +  P  FID R KR+ S +F +H+FG   V S+DP+ N+++LQNEG+ F+  YP ++  L+G + LL + G L +++H + ++      ++   + +I  LV   +D W D+  + L  E  ++   L  KQL+   P++ T  +
Sbjct:   57 ETYSYYRSMTSNRPRQFIDDREKRYDSDVFVSHLFGSQAVISSDPQFNKYVLQNEGRFFQAHYPKALKALIGDYGLLSVHGDLQRKLHGIAVNLLRFERLKFDFMEEIQNLVHSTLDRWVDKKEIALQNECHQMVLNLMAKQLLDLSPSKETNEI 211          
BLAST of CX287068 vs. ExPASy Swiss-Prot
Match: C85A_PHAVU (Cytochrome P450 85A OS=Phaseolus vulgaris GN=BA13 PE=3 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 8.102e-21
Identity = 50/141 (35.46%), Postives = 81/141 (57.45%), Query Frame = 3
Query:  162 FIDVRVKRFGSIFTTHIFGEPTVFSADPETNRFILQNEGKLFECSYPGSISNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIRDHLLVDIDRLVRLHMDSWTDRVL-LMEEAKKITFELTVKQLMSFDPNEWTESLRKEY 581
            F+  +  R+GS F +HI G PT+ S DPE NRFIL NE K     YP S+ ++LG  ++  + GS HK M    +S  + ++IRD LL  ID  +R H+  W ++V+ + E+ K++ F  ++KQ+   + +   +    E+
Sbjct:   57 FMKNKRARYGSFFKSHILGCPTIVSMDPELNRFILMNEAKGLVPGYPQSMLDILGTRNIAAVHGSTHKYMRGALLSIISPTLIRDQLLPKIDEFMRTHLMDWDNKVINIQEKTKEMAFLSSLKQIAGMESSSIAQPFMTEF 197          
BLAST of CX287068 vs. ExPASy Swiss-Prot
Match: C85A1_SOLLC (Cytochrome P450 85A1 OS=Solanum lycopersicum GN=CYP85A1 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 6.859e-20
Identity = 48/134 (35.82%), Postives = 77/134 (57.46%), Query Frame = 3
Query:  183 RFGSIFTTHIFGEPTVFSADPETNRFILQNEGKLFECSYPGSISNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIRDHLLVDIDRLVRLHMDSWTDRVL-LMEEAKKITFELTVKQLMSFDPNEWTESLRKEY 581
            R+GS F +HI G PT+ S D E NR+IL NE K     YP S+ ++LGK ++  + GS HK M    +S  + ++IRD LL  ID  +R H+ +W ++V+ + E+  K+ F  ++KQ+   +     +    E+
Sbjct:   64 RYGSFFKSHILGCPTIVSMDSELNRYILVNEAKGLVPGYPQSMIDILGKCNIAAVNGSAHKYMRGALLSLISPTMIRDQLLPKIDEFMRSHLTNWDNKVIDIQEKTNKMAFLSSLKQIAGIESTSLAQEFMSEF 197          
BLAST of CX287068 vs. ExPASy Swiss-Prot
Match: C72B2_PINTA (Cytochrome P450 720B2 OS=Pinus taeda GN=CYP720B2 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.446e-19
Identity = 47/145 (32.41%), Postives = 80/145 (55.17%), Query Frame = 3
Query:  144 TENPEPFIDVRVKRFGSIFTTHIFGEPT-VFSADPETNRFILQNEGKLFECSYPGSISNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIRDHLLVDIDRLVRLHMDSWTDR--VLLMEEAKKITFELTVKQLMSFDPNEWTESL 569
            T  P  FI  R +R+G IF +++FG    V S DPE N+ +LQ+EG+ F+ +YP  + NL+GK+ LL + G L +++H   ++      +    + DI  L+ + +  W  +  + L EE  ++   L  KQL+   P++ TE +
Sbjct:   67 TAQPRQFIQEREQRYGEIFRSNLFGRSRIVVSVDPEFNKHVLQHEGRQFQANYPKPLRNLIGKYGLLSVHGDLQRKLHGAAVNLLRFERLSVDFMEDIQNLLHITLAKWEAKRDIHLQEECHQLVLNLMAKQLLDLSPSKDTEEI 211          
The following BLAST results are available for this feature:
BLAST of CX287068 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
C90A1_ARATH1.964e-7585.90Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CY... [more]
C90B1_ARATH1.574e-3244.03Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CY... [more]
C90C1_ARATH1.864e-2539.87Cytochrome P450 90C1 OS=Arabidopsis thaliana GN=RO... [more]
C724B_ORYSJ7.830e-2434.62Cytochrome P450 724B1 OS=Oryza sativa subsp. japon... [more]
C90D2_ORYSJ2.278e-2335.85Cytochrome P450 90D2 OS=Oryza sativa subsp. japoni... [more]
C87A3_ORYSJ6.628e-2335.85Cytochrome P450 87A3 OS=Oryza sativa subsp. japoni... [more]
C72B1_PINTA1.250e-2130.97Abietadienol/abietadienal oxidase OS=Pinus taeda G... [more]
C85A_PHAVU8.102e-2135.46Cytochrome P450 85A OS=Phaseolus vulgaris GN=BA13 ... [more]
C85A1_SOLLC6.859e-2035.82Cytochrome P450 85A1 OS=Solanum lycopersicum GN=CY... [more]
C72B2_PINTA4.446e-1932.41Cytochrome P450 720B2 OS=Pinus taeda GN=CYP720B2 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01004C11SK Veg1 Citrus clementina cDNA clone C01004C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287068 ID=CX287068|Name=CX287068|organism=Citrus clementina|type=EST|length=581bp
ATGATCTCGTTCTTTATATTTCCATTTCCACAGTCATTTTCTTTATTATA
AAAAGGTCCCGGAGCCGGCGGCTGCGGTTGCCGCCGGGAAGCCTCGGCCT
GCCCTTTCTTGGGGAGACCTTGCAACTCATAGCCGCATACAAAACTGAGA
ACCCGGAGCCCTTCATTGACGTGAGGGTGAAGCGGTTCGGTTCGATATTC
ACAACCCACATATTTGGCGAGCCGACGGTGTTCTCCGCCGACCCGGAAAC
GAACCGGTTCATCTTGCAGAATGAAGGGAAGTTGTTCGAGTGCAGCTACC
CCGGCTCGATATCGAACCTTCTGGGGAAGCACTCGTTGCTGCTGATGAAG
GGGAGTCTTCATAAGAGAATGCATTCTTTAACCATGAGCTTCGCTAATTC
GTCGATCATTAGAGACCATCTTTTGGTCGACATAGACCGGCTGGTCCGGC
TCCATATGGATTCCTGGACCGACCGGGTCCTTCTCATGGAAGAAGCCAAG
AAGATAACATTTGAGTTAACAGTGAAGCAGCTGATGAGTTTTGATCCGAA
TGAATGGACCGAGAGTCTCAGAAAAGAATAC
back to top