CX287073

Overview
NameCX287073
Unique NameCX287073
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length554
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13420 contig Ccv1_Contig13420:674..1227. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287073 vs. ExPASy Swiss-Prot
Match: CB13_SOLLC (Chlorophyll a-b binding protein 8, chloroplastic OS=Solanum lycopersicum GN=CAB8 PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 9.832e-50
Identity = 96/117 (82.05%), Postives = 101/117 (86.32%), Query Frame = -1
Query:  204 VLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXGKDEQSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 554
            VLEMALMGFAEHRRFQDWA PGSMG+QYFLG EK LGGSGDPAY           GKDE+SMK+ KLKE+KNGRLAMLAILGYF+Q LVTGVGPYQNLLDHLADPVNNNVLTSLKFH
Sbjct:  157 VLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGLGGSGDPAYPGGPLFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQALVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273          
BLAST of CX287073 vs. ExPASy Swiss-Prot
Match: CB23_PEA (Chlorophyll a-b binding protein 3, chloroplastic OS=Pisum sativum GN=lhca3 PE=1 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 8.323e-49
Identity = 94/117 (80.34%), Postives = 101/117 (86.32%), Query Frame = -1
Query:  204 VLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXGKDEQSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 554
            VLEMALMGFAEHRRFQDWA PGSMG+QYFLG EK  GGSG+PAY           GKDE+S+K+ KLKEVKNGRLAMLAILGYF+QGLVTGVGPYQNLLDH+ADPVNNNVLTSLKFH
Sbjct:  159 VLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNNVLTSLKFH 275          
BLAST of CX287073 vs. ExPASy Swiss-Prot
Match: CB25_NICPL (Chlorophyll a-b binding protein E, chloroplastic OS=Nicotiana plumbaginifolia GN=CABE PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.288e-14
Identity = 39/75 (52.00%), Postives = 49/75 (65.33%), Query Frame = -1
Query:  228 YLGGSGDPAYXXXXXXXXXXXGKDEQSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 452
            Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ LVTG GP +NL DHLADPVNNN
Sbjct:  190 YPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQALVTGKGPLENLADHLADPVNNN 254          
BLAST of CX287073 vs. ExPASy Swiss-Prot
Match: CB21_SINAL (Chlorophyll a-b binding protein 1, chloroplastic OS=Sinapis alba GN=CAB1 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.288e-14
Identity = 47/107 (43.93%), Postives = 60/107 (56.07%), Query Frame = -1
Query:  228 EMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXGKDEQSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 548
            ++ LMG  E  R    A  G +G    L    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  164 QVILMGAVEGYRV---AGEGPLGEAEDL---LYPGGSFDPL----------GLATDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 254          
BLAST of CX287073 vs. ExPASy Swiss-Prot
Match: CB21_RAPSA (Chlorophyll a-b binding of LHCII type 1 protein (Fragment) OS=Raphanus sativus PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.288e-14
Identity = 47/107 (43.93%), Postives = 60/107 (56.07%), Query Frame = -1
Query:  228 EMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXGKDEQSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 548
            ++ LMG  E  R    A  G +G    L    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:   22 QVILMGAVEGYRV---AGDGPLGEAEDL---LYPGGSFDPL----------ASLTDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 112          
BLAST of CX287073 vs. ExPASy Swiss-Prot
Match: CB2D_SOLLC (Chlorophyll a-b binding protein 1D (Fragment) OS=Solanum lycopersicum GN=CAB1D PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.902e-14
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = -1
Query:  228 YLGGSGDPAYXXXXXXXXXXXGKDEQSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 452
            Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:   40 YPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 104          
BLAST of CX287073 vs. ExPASy Swiss-Prot
Match: CB2C_SOLLC (Chlorophyll a-b binding protein 1C, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB1C PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.902e-14
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = -1
Query:  228 YLGGSGDPAYXXXXXXXXXXXGKDEQSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 452
            Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  189 YPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 253          
BLAST of CX287073 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.902e-14
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = -1
Query:  228 YLGGSGDPAYXXXXXXXXXXXGKDEQSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 452
            Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  189 YPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 253          
BLAST of CX287073 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.902e-14
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = -1
Query:  228 YLGGSGDPAYXXXXXXXXXXXGKDEQSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 452
            Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  198 YPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN 262          
BLAST of CX287073 vs. ExPASy Swiss-Prot
Match: CB2A_SOLLC (Chlorophyll a-b binding protein 1A, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB1A PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.902e-14
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = -1
Query:  228 YLGGSGDPAYXXXXXXXXXXXGKDEQSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 452
            Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  189 YPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 253          
The following BLAST results are available for this feature:
BLAST of CX287073 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 69
Match NameE-valueIdentityDescription
CB13_SOLLC9.832e-5082.05Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB23_PEA8.323e-4980.34Chlorophyll a-b binding protein 3, chloroplastic O... [more]
CB25_NICPL2.288e-1452.00Chlorophyll a-b binding protein E, chloroplastic O... [more]
CB21_SINAL2.288e-1443.93Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB21_RAPSA2.288e-1443.93Chlorophyll a-b binding of LHCII type 1 protein (F... [more]
CB2D_SOLLC3.902e-1450.67Chlorophyll a-b binding protein 1D (Fragment) OS=S... [more]
CB2C_SOLLC3.902e-1450.67Chlorophyll a-b binding protein 1C, chloroplastic ... [more]
CB2B_SOLLC3.902e-1450.67Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB2B_PINSY3.902e-1450.67Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB2A_SOLLC3.902e-1450.67Chlorophyll a-b binding protein 1A, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01004D04SK Veg1 Citrus clementina cDNA clone C01004D04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287073 ID=CX287073|Name=CX287073|organism=Citrus clementina|type=EST|length=554bp
TTTTTTTTTTTTTAGCTAATCTAACAGTACATAAATTAATAACTAATAGA
TCCAGTTTAGCAATTAACATGTCATTTCCGCCAAGTTACATTCACTTTTC
ACATAAATAATTTTACAATGGGGAAAGTAGAATACAACAGAGTGGGGGAT
GACAAGGCTTGGAATATATAATTCCAAGCAATGAACAAGAAATTTCTCTC
TCAGTGAAACTTGAGGCTAGTCAAAACATTGTTGTTGACAGGATCAGCCA
AGTGATCCAATAGGTTCTGGTAAGGCCCAACTCCTGTAACAAGACCTTGA
ACAAAGTAACCCAAGATTGCCAACATTGCCAATCTTCCATTCTTCACTTC
CTTGAGCTTGAAATCCTTCATTGACTGCTCATCTTTCCCAAGACCCAGAG
GGTTGAATAGAGGTCCTCCAGGGTAAGCCGGATCGCCGGATCCTCCCAAG
TATTTCTCGAATCCGAGGAAGTATTGCCTGCCCATTGATCCTGGATTTGC
CCAGTCTTGGAATCTCCGGTGCTCGGCAAATCCCATGAGTGCCATTTCCA
GGAC
back to top