CX287080

Overview
NameCX287080
Unique NameCX287080
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length141
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14593 contig Ccv1_Contig14593:129..269. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287080 vs. ExPASy Swiss-Prot
Match: DHAR1_ARATH (Glutathione S-transferase DHAR1, mitochondrial OS=Arabidopsis thaliana GN=DHAR1 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.273e-17
Identity = 40/47 (85.11%), Postives = 43/47 (91.49%), Query Frame = 1
Query:    1 VKAAVGAPDILGDCPFSQRALLTLEEKKVPYKRHLINISDKPQWFLE 141
            VKAAVGAPD LGDCPFSQRALLTLEEK + YK HLIN+SDKPQWFL+
Sbjct:    7 VKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLD 53          
The following BLAST results are available for this feature:
BLAST of CX287080 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
DHAR1_ARATH5.273e-1785.11Glutathione S-transferase DHAR1, mitochondrial OS=... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01004E01SK Veg1 Citrus clementina cDNA clone C01004E01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287080 ID=CX287080|Name=CX287080|organism=Citrus clementina|type=EST|length=141bp
GTGAAAGCCGCTGTTGGCGCTCCTGATATTCTCGGGGACTGCCCATTTTC
CCAAAGAGCTTTGCTTACTTTGGAGGAAAAGAAAGTTCCATACAAGCGTC
ACCTTATCAATATCAGTGACAAGCCTCAATGGTTTTTGGAG
back to top