CX287081

Overview
NameCX287081
Unique NameCX287081
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length269
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10194 contig Ccv1_Contig10194:119..387. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287081 vs. ExPASy Swiss-Prot
Match: RS263_ARATH (40S ribosomal protein S26-3 OS=Arabidopsis thaliana GN=RPS26C PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 6.347e-26
Identity = 57/90 (63.33%), Postives = 61/90 (67.78%), Query Frame = 3
Query:    3 IRCSNCGKCCPKDKAIKRFLVRNIAEQAAVRDVQEARVYDGYTLPKLYAKMQYCXXXXXXXXXXXXXXXXXXXXXEPPQRFMRR-DDVPK 269
            IRCSNCGKCCPKDKAIKRF+VRNI EQAA+RDVQEA VY+GYTLPKLYAK QYC                      PP RF RR +D PK
Sbjct:   21 IRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPK 110          
BLAST of CX287081 vs. ExPASy Swiss-Prot
Match: RS262_ARATH (40S ribosomal protein S26-2 OS=Arabidopsis thaliana GN=RPS26B PE=2 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 6.347e-26
Identity = 57/90 (63.33%), Postives = 61/90 (67.78%), Query Frame = 3
Query:    3 IRCSNCGKCCPKDKAIKRFLVRNIAEQAAVRDVQEARVYDGYTLPKLYAKMQYCXXXXXXXXXXXXXXXXXXXXXEPPQRFMRR-DDVPK 269
            IRCSNCGKCCPKDKAIKRF+VRNI EQAA+RDVQEA VY+GYTLPKLYAK QYC                      PP RF RR +D PK
Sbjct:   21 IRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPK 110          
BLAST of CX287081 vs. ExPASy Swiss-Prot
Match: RS261_ARATH (40S ribosomal protein S26-1 OS=Arabidopsis thaliana GN=RPS26A PE=2 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 6.347e-26
Identity = 57/90 (63.33%), Postives = 61/90 (67.78%), Query Frame = 3
Query:    3 IRCSNCGKCCPKDKAIKRFLVRNIAEQAAVRDVQEARVYDGYTLPKLYAKMQYCXXXXXXXXXXXXXXXXXXXXXEPPQRFMRR-DDVPK 269
            IRCSNCGKCCPKDKAIKRF+VRNI EQAA+RDVQEA VY+GYTLPKLYAK QYC                      PP RF RR +D PK
Sbjct:   21 IRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFTRRKEDTPK 110          
BLAST of CX287081 vs. ExPASy Swiss-Prot
Match: RS26_ORYSJ (40S ribosomal protein S26 OS=Oryza sativa subsp. japonica GN=RPS26 PE=2 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 5.941e-24
Identity = 52/89 (58.43%), Postives = 59/89 (66.29%), Query Frame = 3
Query:    3 IRCSNCGKCCPKDKAIKRFLVRNIAEQAAVRDVQEARVYDGYTLPKLYAKMQYCXXXXXXXXXXXXXXXXXXXXXEPPQRFMRRDDVPK 269
            IRCSNC KCCPKDKAIKRF VRNI EQAA+RDVQEA V+DGY LPKLYAK+ +C                      PP+RF RR+D P+
Sbjct:   21 IRCSNCAKCCPKDKAIKRFQVRNIVEQAAIRDVQEACVHDGYVLPKLYAKVHHCVSCAIHAHIVRVRSRENRRDRRPPERFRRREDRPQ 109          
BLAST of CX287081 vs. ExPASy Swiss-Prot
Match: RS26_CAEEL (40S ribosomal protein S26 OS=Caenorhabditis elegans GN=rps-26 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.730e-18
Identity = 42/84 (50.00%), Postives = 50/84 (59.52%), Query Frame = 3
Query:    3 IRCSNCGKCCPKDKAIKRFLVRNIAEQAAVRDVQEARVYDGYTLPKLYAKMQYCXXXXXXXXXXXXXXXXXXXXXEPPQRFMRR 254
            IRC+NCG+CCPKDKAIK+F+VRNI E AAVRD+ +A  Y  Y LPKLY K+ YC                      PP RF +R
Sbjct:   21 IRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALPKLYHKLHYCIACAIHSKVVRNRSREARRDRNPPPRFGQR 104          
BLAST of CX287081 vs. ExPASy Swiss-Prot
Match: RS26_RAT (40S ribosomal protein S26 OS=Rattus norvegicus GN=Rps26 PE=3 SV=3)

HSP 1 Score: 88.9669 bits (219), Expect = 8.309e-18
Identity = 41/89 (46.07%), Postives = 50/89 (56.18%), Query Frame = 3
Query:    3 IRCSNCGKCCPKDKAIKRFLVRNIAEQAAVRDVQEARVYDGYTLPKLYAKMQYCXXXXXXXXXXXXXXXXXXXXXEPPQRFMRRDDVPK 269
            IRC+NC +C PKDKAIK+F++RNI E AAVRD+ EA V+D Y LPKLY K+ YC                      PP RF      P+
Sbjct:   21 IRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPR 109          
BLAST of CX287081 vs. ExPASy Swiss-Prot
Match: RS26_PIG (40S ribosomal protein S26 OS=Sus scrofa GN=RPS26 PE=3 SV=4)

HSP 1 Score: 88.9669 bits (219), Expect = 8.309e-18
Identity = 41/89 (46.07%), Postives = 50/89 (56.18%), Query Frame = 3
Query:    3 IRCSNCGKCCPKDKAIKRFLVRNIAEQAAVRDVQEARVYDGYTLPKLYAKMQYCXXXXXXXXXXXXXXXXXXXXXEPPQRFMRRDDVPK 269
            IRC+NC +C PKDKAIK+F++RNI E AAVRD+ EA V+D Y LPKLY K+ YC                      PP RF      P+
Sbjct:   21 IRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPR 109          
BLAST of CX287081 vs. ExPASy Swiss-Prot
Match: RS26_MOUSE (40S ribosomal protein S26 OS=Mus musculus GN=Rps26 PE=2 SV=3)

HSP 1 Score: 88.9669 bits (219), Expect = 8.309e-18
Identity = 41/89 (46.07%), Postives = 50/89 (56.18%), Query Frame = 3
Query:    3 IRCSNCGKCCPKDKAIKRFLVRNIAEQAAVRDVQEARVYDGYTLPKLYAKMQYCXXXXXXXXXXXXXXXXXXXXXEPPQRFMRRDDVPK 269
            IRC+NC +C PKDKAIK+F++RNI E AAVRD+ EA V+D Y LPKLY K+ YC                      PP RF      P+
Sbjct:   21 IRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPR 109          
BLAST of CX287081 vs. ExPASy Swiss-Prot
Match: RS26_MACFA (40S ribosomal protein S26 OS=Macaca fascicularis GN=RPS26 PE=3 SV=3)

HSP 1 Score: 88.9669 bits (219), Expect = 8.309e-18
Identity = 41/89 (46.07%), Postives = 50/89 (56.18%), Query Frame = 3
Query:    3 IRCSNCGKCCPKDKAIKRFLVRNIAEQAAVRDVQEARVYDGYTLPKLYAKMQYCXXXXXXXXXXXXXXXXXXXXXEPPQRFMRRDDVPK 269
            IRC+NC +C PKDKAIK+F++RNI E AAVRD+ EA V+D Y LPKLY K+ YC                      PP RF      P+
Sbjct:   21 IRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPR 109          
BLAST of CX287081 vs. ExPASy Swiss-Prot
Match: RS26_HUMAN (40S ribosomal protein S26 OS=Homo sapiens GN=RPS26 PE=1 SV=3)

HSP 1 Score: 88.9669 bits (219), Expect = 8.309e-18
Identity = 41/89 (46.07%), Postives = 50/89 (56.18%), Query Frame = 3
Query:    3 IRCSNCGKCCPKDKAIKRFLVRNIAEQAAVRDVQEARVYDGYTLPKLYAKMQYCXXXXXXXXXXXXXXXXXXXXXEPPQRFMRRDDVPK 269
            IRC+NC +C PKDKAIK+F++RNI E AAVRD+ EA V+D Y LPKLY K+ YC                      PP RF      P+
Sbjct:   21 IRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPR 109          
The following BLAST results are available for this feature:
BLAST of CX287081 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
RS263_ARATH6.347e-2663.3340S ribosomal protein S26-3 OS=Arabidopsis thalian... [more]
RS262_ARATH6.347e-2663.3340S ribosomal protein S26-2 OS=Arabidopsis thalian... [more]
RS261_ARATH6.347e-2663.3340S ribosomal protein S26-1 OS=Arabidopsis thalian... [more]
RS26_ORYSJ5.941e-2458.4340S ribosomal protein S26 OS=Oryza sativa subsp. j... [more]
RS26_CAEEL3.730e-1850.0040S ribosomal protein S26 OS=Caenorhabditis elegan... [more]
RS26_RAT8.309e-1846.0740S ribosomal protein S26 OS=Rattus norvegicus GN=... [more]
RS26_PIG8.309e-1846.0740S ribosomal protein S26 OS=Sus scrofa GN=RPS26 P... [more]
RS26_MOUSE8.309e-1846.0740S ribosomal protein S26 OS=Mus musculus GN=Rps26... [more]
RS26_MACFA8.309e-1846.0740S ribosomal protein S26 OS=Macaca fascicularis G... [more]
RS26_HUMAN8.309e-1846.0740S ribosomal protein S26 OS=Homo sapiens GN=RPS26... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01004E02SK Veg1 Citrus clementina cDNA clone C01004E02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287081 ID=CX287081|Name=CX287081|organism=Citrus clementina|type=EST|length=269bp
TCATCCGCTGCTCTAACTGCGGCAAATGCTGCCCTAAGGACAAGGCGATT
AAGAGGTTTTTGGTGAGGAACATTGCTGAGCAAGCTGCTGTTAGGGATGT
TCAGGAGGCGCGTGTTTATGACGGTTACACTCTTCCTAAGTTATATGCTA
AGATGCAGTACTGCGTCTCGAGTGCGATCCACTCTCATGTGGTGAGAGTT
CGGTCCCGTACTAACAGGAGGATCCGCGAGCCCCCGCAACGCTTCATGCG
CAGGGATGATGTCCCAAAG
back to top