CX287089

Overview
NameCX287089
Unique NameCX287089
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length456
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX287089 vs. ExPASy Swiss-Prot
Match: GLYN_FLAPR (Serine hydroxymethyltransferase 2, mitochondrial OS=Flaveria pringlei PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.231e-18
Identity = 44/49 (89.80%), Postives = 46/49 (93.88%), Query Frame = -1
Query:  310 QGTKLKDFVATTQSANFQSEIAKLRHDVEEYAKQFPTIGFEKETMKYKN 456
            QGTKLKDFVA  QS+ FQSEI+KLRHDVEEYAKQFPTIGFEKETMKYKN
Sbjct:  469 QGTKLKDFVAAMQSSAFQSEISKLRHDVEEYAKQFPTIGFEKETMKYKN 517          
BLAST of CX287089 vs. ExPASy Swiss-Prot
Match: GLYM_SOLTU (Serine hydroxymethyltransferase, mitochondrial OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 5.172e-17
Identity = 44/50 (88.00%), Postives = 46/50 (92.00%), Query Frame = -1
Query:  310 QGTKLKDFVATTQS-ANFQSEIAKLRHDVEEYAKQFPTIGFEKETMKYKN 456
            QGTKLKDFVAT +S A  +SEIAKLRHDVEEYAKQFPTIGFEKETMKYKN
Sbjct:  469 QGTKLKDFVATLESSAPIKSEIAKLRHDVEEYAKQFPTIGFEKETMKYKN 518          
BLAST of CX287089 vs. ExPASy Swiss-Prot
Match: GLYM_FLAPR (Serine hydroxymethyltransferase 1, mitochondrial OS=Flaveria pringlei PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.152e-16
Identity = 40/49 (81.63%), Postives = 44/49 (89.80%), Query Frame = -1
Query:  310 QGTKLKDFVATTQSANFQSEIAKLRHDVEEYAKQFPTIGFEKETMKYKN 456
            +GTKLKDFV   +S+  QSEI+KLRHDVEEYAKQFPTIGFEKETMKYKN
Sbjct:  469 KGTKLKDFVTAMESSAIQSEISKLRHDVEEYAKQFPTIGFEKETMKYKN 517          
BLAST of CX287089 vs. ExPASy Swiss-Prot
Match: GLYM_ARATH (Serine hydroxymethyltransferase, mitochondrial OS=Arabidopsis thaliana GN=SHM1 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.274e-15
Identity = 40/50 (80.00%), Postives = 46/50 (92.00%), Query Frame = -1
Query:  310 QGTKLKDFVATTQSAN-FQSEIAKLRHDVEEYAKQFPTIGFEKETMKYKN 456
            QGTKLKDFV+  +S++  QSEIAKLRH+VEE+AKQFPTIGFEKETMKYKN
Sbjct:  468 QGTKLKDFVSAMESSSTIQSEIAKLRHEVEEFAKQFPTIGFEKETMKYKN 517          
BLAST of CX287089 vs. ExPASy Swiss-Prot
Match: GLYM_PEA (Serine hydroxymethyltransferase, mitochondrial OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 4.531e-13
Identity = 35/48 (72.92%), Postives = 43/48 (89.58%), Query Frame = -1
Query:  316 QGTKLKDFVATTQSANF-QSEIAKLRHDVEEYAKQFPTIGFEKETMKY 456
            +GTKLKDFV   Q++++ QSEI+KL+HDVEE+AKQFPTIGFEK TMKY
Sbjct:  469 KGTKLKDFVEALQTSSYVQSEISKLKHDVEEFAKQFPTIGFEKATMKY 516          
The following BLAST results are available for this feature:
BLAST of CX287089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
GLYN_FLAPR1.231e-1889.80Serine hydroxymethyltransferase 2, mitochondrial O... [more]
GLYM_SOLTU5.172e-1788.00Serine hydroxymethyltransferase, mitochondrial OS=... [more]
GLYM_FLAPR1.152e-1681.63Serine hydroxymethyltransferase 1, mitochondrial O... [more]
GLYM_ARATH1.274e-1580.00Serine hydroxymethyltransferase, mitochondrial OS=... [more]
GLYM_PEA4.531e-1372.92Serine hydroxymethyltransferase, mitochondrial OS=... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01004E11SK Veg1 Citrus clementina cDNA clone C01004E11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287089 ID=CX287089|Name=CX287089|organism=Citrus clementina|type=EST|length=456bp
CTCGTGCCGAATTCGGCACGAGGGAGTTTTTTTTTTTTTTTTTTTTGAAA
AAAGATATCGCTTCTAGTTTTATTGCAGGTTTATTTGCTTCCTGAAAGCC
TCAGTAAATACAGAGTACTTTATATACATTAATTGTGATCTAAATCAAGG
TTTGCTGCTATGGTATTCATAAAAGCGCCAAATCACAGGGTCGATAGTTG
ATACATGGCTCATCATCATAAGTTACATTTCATCCCTCGTCGCCTCTGTG
TAATAAAAGCTCATACAGGCTGGCTTCTGCTGCTCTAGTACAGTGGCGTT
TTTCTCTCAGTTCTTGTACTTCATGGTTTCCTTTTCAAACCCAATTGTGG
GGAACTGCTTTGCATACTCCTCAACATCATGGCGAAGTTTCGCAATCTCG
GATTGGAAGTTAGCGGACTGTGTTGTGGCCACGAAATCTTTCAACTTTGT
TCCTTG
back to top