CX287101

Overview
NameCX287101
Unique NameCX287101
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length477
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX287101_ssr105 microsatellite CX287101_ssr105:105..116. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig2991 contig Ccv1_Contig2991:100..576. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287101 vs. ExPASy Swiss-Prot
Match: RLMN_SYNS9 (Ribosomal RNA large subunit methyltransferase N OS=Synechococcus sp. (strain CC9902) GN=rlmN PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.195e-19
Identity = 50/113 (44.25%), Postives = 68/113 (60.18%), Query Frame = 1
Query:  139 NVLLGMSEQELQKLAVDLGQQSYRGKQLHHLIYKRKVKEIENFIQLPQSFRNDLQEAGWTVGRLPIFRTVTAADGTVKLLIKLEDNRLIETVGIPVEDEKGPMRLTACVSSQV 477
            NVLLG S  EL+  AV  G +S+RG+Q+H  +Y + VK +     LP+ +R +L+   + VGRL +     AAD T KLL+  +D   IETVGIP +      RLT C+SSQV
Sbjct:    3 NVLLGRSAAELEDWAVAQGHKSFRGRQIHDWLYNKGVKSLSEISALPKQWRTELEAQTFRVGRLKLVHQSVAADATTKLLLATDDGETIETVGIPTD-----QRLTVCISSQV 110          
BLAST of CX287101 vs. ExPASy Swiss-Prot
Match: RLMN_SYNS3 (Ribosomal RNA large subunit methyltransferase N OS=Synechococcus sp. (strain CC9311) GN=rlmN PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.089e-18
Identity = 50/113 (44.25%), Postives = 71/113 (62.83%), Query Frame = 1
Query:  139 NVLLGMSEQELQKLAVDLGQQSYRGKQLHHLIYKRKVKEIENFIQLPQSFRNDLQEAGWTVGRLPIFRTVTAADGTVKLLIKLEDNRLIETVGIPVEDEKGPMRLTACVSSQV 477
            + LLG S+ EL++ AV  GQ ++RG+QLH  +Y + V++++    LP+++R  LQ  G +VGRL       +AD T KLL+  ED   +ETVGIP +      RLT CVSSQV
Sbjct:    3 SALLGRSKSELEEWAVAQGQPAFRGRQLHDWLYAKGVRDLQGITVLPKAWRASLQNEGVSVGRLHEQERRVSADATTKLLLGTEDGETLETVGIPTD-----QRLTVCVSSQV 110          
BLAST of CX287101 vs. ExPASy Swiss-Prot
Match: RLMN_PROMT (Ribosomal RNA large subunit methyltransferase N OS=Prochlorococcus marinus (strain NATL2A) GN=rlmN PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.422e-18
Identity = 48/122 (39.34%), Postives = 77/122 (63.11%), Query Frame = 1
Query:  115 SRAPRVDANV-LLGMSEQELQKLAVDLGQQSYRGKQLHHLIYKRKVKEIENFIQLPQSFRNDLQEAGWTVGRLPIFRTVTAADGTVKLLIKLEDNRLIETVGIPVEDEKGPMRLTACVSSQV 477
            ++ P++ +N  LLG+S ++L++ A   G++S+RG+Q+H  IY+R  K +++   LP+ +R+ L   G  +GRL     V A D T+KLL+   D  ++ETVGIP +      RLT CVSSQ+
Sbjct:    2 TKLPKLSSNSSLLGLSSEDLEEFARQEGEKSFRGRQIHEWIYQRGAKSLDSISVLPKKWRDSLVRKGIQIGRLDEINRVVAEDETLKLLMGTFDGEIVETVGIPTD-----KRLTVCVSSQI 118          
BLAST of CX287101 vs. ExPASy Swiss-Prot
Match: RLMN_PROM1 (Ribosomal RNA large subunit methyltransferase N OS=Prochlorococcus marinus (strain NATL1A) GN=rlmN PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.422e-18
Identity = 48/122 (39.34%), Postives = 77/122 (63.11%), Query Frame = 1
Query:  115 SRAPRVDANV-LLGMSEQELQKLAVDLGQQSYRGKQLHHLIYKRKVKEIENFIQLPQSFRNDLQEAGWTVGRLPIFRTVTAADGTVKLLIKLEDNRLIETVGIPVEDEKGPMRLTACVSSQV 477
            ++ P++ +N  LLG+S ++L++ A   G++S+RG+Q+H  IY+R  K +++   LP+ +R+ L   G  +GRL     V A D T+KLL+   D  ++ETVGIP +      RLT CVSSQ+
Sbjct:    2 TKLPKLSSNSSLLGLSSEDLEEFARQEGEKSFRGRQIHEWIYQRGAKSLDSISVLPKKWRDSLVRKGIQIGRLDEINRVVAEDETLKLLMGTFDGEIVETVGIPTD-----KRLTVCVSSQI 118          
BLAST of CX287101 vs. ExPASy Swiss-Prot
Match: RLMN_PROM4 (Ribosomal RNA large subunit methyltransferase N OS=Prochlorococcus marinus (strain MIT 9211) GN=rlmN PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.426e-18
Identity = 47/112 (41.96%), Postives = 70/112 (62.50%), Query Frame = 1
Query:  142 VLLGMSEQELQKLAVDLGQQSYRGKQLHHLIYKRKVKEIENFIQLPQSFRNDLQEAGWTVGRLPIFRTVTAADGTVKLLIKLEDNRLIETVGIPVEDEKGPMRLTACVSSQV 477
            VLLG +  +L+KLA + G+ ++RG+Q+H  +Y++ V+++E    LP+ +R  L + G   GRL   + + A DGT+KLL++  D   IE VGIP        RLT CVSSQV
Sbjct:   12 VLLGQNVAKLEKLAQEYGEPAFRGRQIHEWLYQKGVRKLEEISVLPKLWRTTLSDQGVCTGRLEEVKRLVANDGTIKLLLETSDRESIEAVGIPTNS-----RLTTCVSSQV 118          
BLAST of CX287101 vs. ExPASy Swiss-Prot
Match: RLMN_SYNPX (Ribosomal RNA large subunit methyltransferase N OS=Synechococcus sp. (strain WH8102) GN=rlmN PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.169e-18
Identity = 50/112 (44.64%), Postives = 66/112 (58.93%), Query Frame = 1
Query:  142 VLLGMSEQELQKLAVDLGQQSYRGKQLHHLIYKRKVKEIENFIQLPQSFRNDLQEAGWTVGRLPIFRTVTAADGTVKLLIKLEDNRLIETVGIPVEDEKGPMRLTACVSSQV 477
            +LLG S  EL+  AV  GQ+ +RG+QLH  +Y +  + +     LP+++R  L+E G  VGRL       AAD T KLL+  +D   IETVGIP +      RLT CVSSQV
Sbjct:    1 MLLGRSAAELESWAVAQGQKPFRGRQLHDWLYAKGARSLSEITVLPKAWRESLKEDGVEVGRLKEVHRSVAADATTKLLLSTDDGETIETVGIPTD-----QRLTVCVSSQV 107          
BLAST of CX287101 vs. ExPASy Swiss-Prot
Match: RLMN_SYNSC (Ribosomal RNA large subunit methyltransferase N OS=Synechococcus sp. (strain CC9605) GN=rlmN PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 9.220e-18
Identity = 52/111 (46.85%), Postives = 64/111 (57.66%), Query Frame = 1
Query:  145 LLGMSEQELQKLAVDLGQQSYRGKQLHHLIYKRKVKEIENFIQLPQSFRNDLQEAGWTVGRLPIFRTVTAADGTVKLLIKLEDNRLIETVGIPVEDEKGPMRLTACVSSQV 477
            LLG S  ELQ  AV  GQ+ +RG+QLH  IY +  + + +    P+++R  L EAG  VGRL       A D T KLL+  ED   IETVGIP +      RLT CVSSQV
Sbjct:    5 LLGRSAAELQDWAVAQGQKPFRGRQLHDWIYAKGARSLADITVFPKTWRAALVEAGVDVGRLKEVHHSVATDATTKLLLSTEDGETIETVGIPTD-----QRLTVCVSSQV 110          
BLAST of CX287101 vs. ExPASy Swiss-Prot
Match: RLMN_PROMA (Ribosomal RNA large subunit methyltransferase N OS=Prochlorococcus marinus GN=rlmN PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.204e-17
Identity = 47/111 (42.34%), Postives = 70/111 (63.06%), Query Frame = 1
Query:  145 LLGMSEQELQKLAVDLGQQSYRGKQLHHLIYKRKVKEIENFIQLPQSFRNDLQEAGWTVGRLPIFRTVTAADGTVKLLIKLEDNRLIETVGIPVEDEKGPMRLTACVSSQV 477
            LLG+   +L++LA+D G+  YRG+QLH  +Y++ V  +++   LP+++RN L + G +VG L       A D T+KLL+   D  +IETVGIP  +     RLT CVSSQ+
Sbjct:    8 LLGLDLSQLERLALDHGESLYRGRQLHQWLYQKGVDNLDDITVLPKAWRNSLIQKGISVGGLVEVNRFIAGDRTIKLLLSTGDGEIIETVGIPSGN-----RLTICVSSQI 113          
BLAST of CX287101 vs. ExPASy Swiss-Prot
Match: RLMN_SYNJA (Ribosomal RNA large subunit methyltransferase N OS=Synechococcus sp. (strain JA-3-3Ab) GN=rlmN PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.054e-17
Identity = 49/111 (44.14%), Postives = 69/111 (62.16%), Query Frame = 1
Query:  145 LLGMSEQELQKLAVDLGQQSYRGKQLHHLIYKRKVKEIENFIQLPQSFRNDLQEAGWTVGRLPIFRTVTAADGTVKLLIKLEDNRLIETVGIPVEDEKGPMRLTACVSSQV 477
            LLG S   L+  AV+ GQ +YRG+QLH  +Y + ++ ++     P+++R  LQE  + VGR  + + + + DGTVK L++L D  LIETVGIP        RLT CVSSQV
Sbjct:    8 LLGQSLAALKDWAVEQGQPAYRGQQLHTWLYHKGIRSLQEVTVFPKAWREALQE--YPVGRSQVVQRIESRDGTVKFLLQLADGELIETVGIPT-----ARRLTVCVSSQV 111          
BLAST of CX287101 vs. ExPASy Swiss-Prot
Match: RLMN_PROM2 (Ribosomal RNA large subunit methyltransferase N OS=Prochlorococcus marinus (strain MIT 9215) GN=rlmN PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.054e-17
Identity = 49/113 (43.36%), Postives = 70/113 (61.95%), Query Frame = 1
Query:  145 LLGMSEQELQKLAVDLGQQSYRGKQLHHLIY--KRKVKEIENFIQLPQSFRNDLQEAGWTVGRLPIFRTVTAADGTVKLLIKLEDNRLIETVGIPVEDEKGPMRLTACVSSQV 477
            LLG S ++L+ +A++ GQ ++RG+Q+H+ IY  + K K I+    LP  FR  L++ G+ +  L +     A DGT+KLL+   DN  IE VGIP E      RLTAC+SSQV
Sbjct:    4 LLGSSVKDLENVALEYGQAAFRGRQIHNWIYNYRNKKKSIDQIEALPLDFRKKLKDDGFKLSELSVQERNLANDGTLKLLLSANDNESIECVGIPTE-----KRLTACLSSQV 111          
The following BLAST results are available for this feature:
BLAST of CX287101 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
RLMN_SYNS92.195e-1944.25Ribosomal RNA large subunit methyltransferase N OS... [more]
RLMN_SYNS31.089e-1844.25Ribosomal RNA large subunit methyltransferase N OS... [more]
RLMN_PROMT1.422e-1839.34Ribosomal RNA large subunit methyltransferase N OS... [more]
RLMN_PROM11.422e-1839.34Ribosomal RNA large subunit methyltransferase N OS... [more]
RLMN_PROM42.426e-1841.96Ribosomal RNA large subunit methyltransferase N OS... [more]
RLMN_SYNPX3.169e-1844.64Ribosomal RNA large subunit methyltransferase N OS... [more]
RLMN_SYNSC9.220e-1846.85Ribosomal RNA large subunit methyltransferase N OS... [more]
RLMN_PROMA1.204e-1742.34Ribosomal RNA large subunit methyltransferase N OS... [more]
RLMN_SYNJA2.054e-1744.14Ribosomal RNA large subunit methyltransferase N OS... [more]
RLMN_PROM22.054e-1743.36Ribosomal RNA large subunit methyltransferase N OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01004F12SK Veg1 Citrus clementina cDNA clone C01004F12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287101 ID=CX287101|Name=CX287101|organism=Citrus clementina|type=EST|length=477bp
ATGACTCTGCTTCGGCAAGTGATCTCTGCTCCCGTAGCACATGCGGTGGT
GCTTTCTCGCTCCTGCCTTGCAGTTTCTGTGACCCCGCGGCGCAAGTTAT
CTGTTTCTTCTTCTTCACGTGCCCCTCGCGTGGACGCCAACGTGCTCCTT
GGCATGTCCGAGCAGGAGCTTCAAAAACTCGCCGTCGACCTCGGCCAGCA
AAGTTACAGAGGGAAGCAGCTTCATCATCTAATTTACAAAAGAAAGGTCA
AAGAAATTGAAAATTTTATTCAACTGCCTCAGTCCTTCAGAAATGATCTC
CAAGAAGCTGGATGGACGGTTGGTCGCTTGCCGATTTTTCGCACGGTCAC
TGCAGCTGATGGAACTGTTAAATTGCTAATAAAGCTGGAAGACAACAGAT
TGATTGAAACTGTTGGCATACCAGTTGAAGACGAGAAAGGTCCCATGCGT
CTTACCGCTTGTGTGTCATCGCAGGTA
back to top