CX287110

Overview
NameCX287110
Unique NameCX287110
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length475
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12192 contig Ccv1_Contig12192:360..834. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287110 vs. ExPASy Swiss-Prot
Match: Y1669_ARATH (Uncharacterized oxidoreductase At1g06690, chloroplastic OS=Arabidopsis thaliana GN=At1g06690 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.494e-12
Identity = 53/153 (34.64%), Postives = 79/153 (51.63%), Query Frame = 1
Query:   31 AEDLYGIFINRVRRERPPEFLDKVRGLTKWVPPPVKMTSSIVRESIDVSRRRMDVPCLDMLQFHWWD-YSNPGYLDALNHLTDLKEEGKIKTVALTNFDTERLRIILEN----GIPVVSNQVQHSVVDMRPQQK-MAELCQLTGVKLITYGTV 471
            +E L G FI R R+ER P    +V   TK+   P +     V  ++  S  R+++  +D+ Q HW   + N GYLD L    D  E+G +K V ++N+  +RLR   E     GIP+ SNQV +S++   P+Q  +   C   GV LI Y  +
Sbjct:  119 SETLLGRFI-RERKERYPGA--EVSVATKFAALPWRFGRESVVTALKDSLSRLELSSVDLYQLHWPGLWGNEGYLDGLG---DAVEQGLVKAVGVSNYSEKRLRDAYERLKKRGIPLASNQVNYSLIYRAPEQTGVKAACDELGVTLIAYSPI 265          
The following BLAST results are available for this feature:
BLAST of CX287110 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y1669_ARATH1.494e-1234.64Uncharacterized oxidoreductase At1g06690, chloropl... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01004G10SK Veg1 Citrus clementina cDNA clone C01004G10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287110 ID=CX287110|Name=CX287110|organism=Citrus clementina|type=EST|length=475bp
GTGCCGAATTCGGCACGAGGCTATGGGCCTGCTGAAGATCTCTATGGCAT
CTTCATCAATCGAGTTCGTCGAGAGAGGCCACCAGAGTTCTTGGATAAGG
TCAGAGGTCTCACTAAATGGGTACCTCCACCAGTCAAGATGACAAGTAGC
ATTGTTAGAGAGAGCATCGATGTATCAAGGAGGCGGATGGATGTACCTTG
CTTGGACATGCTTCAATTTCATTGGTGGGATTATTCTAATCCTGGTTACC
TTGATGCACTAAATCACCTTACAGATCTGAAAGAAGAAGGTAAAATTAAG
ACTGTTGCTTTGACAAATTTTGACACGGAAAGACTGCGAATAATACTGGA
GAATGGTATCCCTGTTGTTAGCAATCAGGTGCAACATTCAGTTGTTGACA
TGCGTCCCCAGCAGAAAATGGCAGAGCTTTGTCAGCTCACAGGAGTCAAA
CTAATAACGTATGGCACAGTAATGG
back to top