CX287112

Overview
NameCX287112
Unique NameCX287112
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length506
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig29 contig Ccv1_Contig29:1..506. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287112 vs. ExPASy Swiss-Prot
Match: RD22_ARATH (Dehydration-responsive protein RD22 OS=Arabidopsis thaliana GN=RD22 PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 8.337e-39
Identity = 72/103 (69.90%), Postives = 82/103 (79.61%), Query Frame = -1
Query:  198 KKGTKMQTYTIAA-GVKQMAADKSVVCHKQNYPYAVFYCHATQTTRAYIVPLEGVDGTKAKAAAVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVW 503
            KK   MQ Y IAA GVK+++ DKSVVCHKQ YP+AVFYCH    T  Y VPLEG +G +AKA AVCH +TSAWNP HLAF+VLKVKPGTVP+CHFLPE H+VW
Sbjct:  287 KKNAPMQKYKIAAAGVKKLSDDKSVVCHKQKYPFAVFYCHKAMMTTVYAVPLEGENGMRAKAVAVCHKNTSAWNPNHLAFKVLKVKPGTVPVCHFLPETHVVW 389          
BLAST of CX287112 vs. ExPASy Swiss-Prot
Match: BURP3_ORYSJ (BURP domain-containing protein 3 OS=Oryza sativa subsp. japonica GN=BURP3 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.068e-33
Identity = 65/106 (61.32%), Postives = 79/106 (74.53%), Query Frame = -1
Query:  198 KKGTKMQTYTIAAGVKQMAA----DKSVVCHKQNYPYAVFYCHATQTTRAYIVPLEGVDGTKAKAAAVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVW 503
            K+G+  Q YT+ A VK+ AA    D+ V CH + Y YAVF CH T+ TRAY V + G DGT  +A AVCH DT+ WNPKH+AFQVLKVKPGTVP+CHFLP+DH+VW
Sbjct:  321 KEGSPEQEYTVTA-VKRAAAGGDQDQLVACHAEPYAYAVFACHLTRATRAYAVSMAGRDGTGVEAVAVCHADTAGWNPKHVAFQVLKVKPGTVPVCHFLPQDHVVW 425          
BLAST of CX287112 vs. ExPASy Swiss-Prot
Match: BURP5_ORYSJ (BURP domain-containing protein 5 OS=Oryza sativa subsp. japonica GN=BURP5 PE=2 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 5.988e-29
Identity = 54/99 (54.55%), Postives = 66/99 (66.67%), Query Frame = -1
Query:  198 TKMQTYTIAAGVKQMAADKSVVCHKQNYPYAVFYCHATQTTRAYIVPLEGVDGTKAKAAAVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVW 494
            T  Q YT+    +     + + CH ++YPYAVF CH T+ TRAY   L G DG   +A AVCHTDT+ WNPKH AFQVL VKPGTVP+CHF+  D +VW
Sbjct:  222 TPAQEYTVTGARRMAETGQLIACHPESYPYAVFMCHLTEATRAYKASLVGKDGAAVEAVAVCHTDTAEWNPKHAAFQVLGVKPGTVPVCHFVQPDVVVW 320          
BLAST of CX287112 vs. ExPASy Swiss-Prot
Match: BURPH_ORYSJ (BURP domain-containing protein 17 OS=Oryza sativa subsp. japonica GN=BURP17 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.276e-28
Identity = 59/105 (56.19%), Postives = 75/105 (71.43%), Query Frame = -1
Query:  198 VKKGTKMQTYTIAAGVKQMAADKSVV-CHKQNYPYAVFYCHATQ-TTRAYIVPLEGVDGTKAKAAAVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVW 506
            V+  +  Q YT++ GV++MA    ++ CH ++YPYAVF CH T+ TTRAY   L G DGT  +A AVCHTDTS WNP+H AF VL VKPGTVP+CHF+  D +VW
Sbjct:  478 VESSSLAQDYTVS-GVRRMAGTGQLIACHPESYPYAVFMCHLTEATTRAYKASLVGKDGTAVEAVAVCHTDTSDWNPEHAAFHVLGVKPGTVPVCHFMQPDAVVW 581          
BLAST of CX287112 vs. ExPASy Swiss-Prot
Match: RAF1B_WHEAT (Protein RAFTIN 1B OS=Triticum aestivum GN=RAFTIN1B PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.381e-25
Identity = 51/108 (47.22%), Postives = 66/108 (61.11%), Query Frame = -1
Query:  183 KKGTKMQTYTIAAGVKQMAADKSVVCHKQNYPYAVFYCHATQTTRAYIVPLEGVDGTKAKA-AAVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVWVPNKK 503
            + G  +QTYT+ A          V CH + YPY V+ CH T  +RAY V +EG  G  A   AAVCHTDTS WNP+H++F++L  KPG  P+CH +P  HI+W  N K
Sbjct:  251 RAGAPLQTYTVVAVQPVEGGPVFVACHDEAYPYTVYRCHTTGPSRAYTVDMEGARGADAVTIAAVCHTDTSLWNPEHVSFKLLGTKPGGTPVCHLMPYGHIIWAKNVK 358          
BLAST of CX287112 vs. ExPASy Swiss-Prot
Match: RAF1A_WHEAT (Protein RAFTIN 1A OS=Triticum aestivum GN=RAFTIN1A PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 3.400e-24
Identity = 48/106 (45.28%), Postives = 65/106 (61.32%), Query Frame = -1
Query:  189 KKGTKMQTYTIAAGVKQMAADKSVVCHKQNYPYAVFYCHATQTTRAYIVPLEGVDGTKAKA-AAVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVWVPN 503
            + G  +QTYT+ +          V CH + YPY V+ CH T  +RAY+V +EG  G  A   A VCHTDTS WNP+H++F++L  KPG  P+CH +P  HI+W  N
Sbjct:  278 RAGAPLQTYTVRSVRPVEGGPVFVACHDEAYPYTVYRCHTTGPSRAYMVDMEGARGGDAVTIATVCHTDTSLWNPEHVSFKLLGTKPGGTPVCHLMPYGHIIWAKN 383          
BLAST of CX287112 vs. ExPASy Swiss-Prot
Match: BURPD_ORYSJ (BURP domain-containing protein 13 OS=Oryza sativa subsp. japonica GN=BURP13 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.866e-22
Identity = 51/110 (46.36%), Postives = 67/110 (60.91%), Query Frame = -1
Query:  180 GTKMQTYTIAAGVKQMAADKSVVCHKQNYPYAVFYCHATQTTRAYIVPLEGV---DGTKA-KAAAVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVWVPNKKT 497
            G  +Q Y + A V  +     V CH Q YPY V+ CH T   RAY+V +EG    DG +A   A VCHT+TS WNP+H++F++L  KPG  P+CH +P  HIVW  N K+
Sbjct:  301 GAPLQAYAVRA-VLPVEGAGFVACHDQAYPYTVYRCHTTGPARAYMVEMEGDGGGDGGEAVTVATVCHTNTSRWNPEHVSFKLLGTKPGGSPVCHLMPYGHIVWAKNVKS 409          
BLAST of CX287112 vs. ExPASy Swiss-Prot
Match: EA92_VICFA (Embryonic abundant protein USP92 OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.478e-19
Identity = 45/99 (45.45%), Postives = 60/99 (60.61%), Query Frame = -1
Query:  189 QTYTIAAGVKQMAADKSVVCHKQNYPYAVFYCHATQTTRAYIVPLEGVDGTKAKAAAVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVWVPN 485
            Q   +   VK++  D +V+CH+ N+   VF CH  + T AY+V L   DGTK KA  VCH DT   NP+ L ++ L+V PGTVP+CHF+      WVPN
Sbjct:  163 QDQYVVEDVKKVG-DNAVMCHRLNFEKVVFNCHQVRETTAYVVSLVASDGTKTKALTVCHHDTRGMNPE-LLYEALEVTPGTVPVCHFIGNKAAAWVPN 259          
BLAST of CX287112 vs. ExPASy Swiss-Prot
Match: EA30_VICFA (Embryonic abundant protein VF30.1 OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.478e-19
Identity = 45/99 (45.45%), Postives = 60/99 (60.61%), Query Frame = -1
Query:  189 QTYTIAAGVKQMAADKSVVCHKQNYPYAVFYCHATQTTRAYIVPLEGVDGTKAKAAAVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVWVPN 485
            Q   +   VK++  D +V+CH+ N+   VF CH  + T AY+V L   DGTK KA  VCH DT   NP+ L ++ L+V PGTVP+CHF+      WVPN
Sbjct:  163 QDQYVVEDVKKVG-DNAVMCHRLNFEKVVFNCHQVRDTTAYVVSLVASDGTKTKALTVCHHDTRGMNPE-LLYEALEVTPGTVPVCHFIGNKAAAWVPN 259          
BLAST of CX287112 vs. ExPASy Swiss-Prot
Match: SVF30_VICFA (Unknown seed protein 30.1 OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.135e-18
Identity = 44/99 (44.44%), Postives = 59/99 (59.60%), Query Frame = -1
Query:  189 QTYTIAAGVKQMAADKSVVCHKQNYPYAVFYCHATQTTRAYIVPLEGVDGTKAKAAAVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVWVPN 485
            Q   +   VK++  D +V+CH+ N+   VF CH  + T AY+V L   DGTK KA  VCH DT   NP+ L ++ L+V  GTVP+CHF+      WVPN
Sbjct:  163 QDQYVVEDVKKVG-DNAVMCHRLNFEKVVFNCHQVRDTTAYVVSLVASDGTKTKALTVCHHDTRGMNPE-LLYEALEVTLGTVPVCHFIGNKAAAWVPN 259          
The following BLAST results are available for this feature:
BLAST of CX287112 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
RD22_ARATH8.337e-3969.90Dehydration-responsive protein RD22 OS=Arabidopsis... [more]
BURP3_ORYSJ3.068e-3361.32BURP domain-containing protein 3 OS=Oryza sativa s... [more]
BURP5_ORYSJ5.988e-2954.55BURP domain-containing protein 5 OS=Oryza sativa s... [more]
BURPH_ORYSJ2.276e-2856.19BURP domain-containing protein 17 OS=Oryza sativa ... [more]
RAF1B_WHEAT1.381e-2547.22Protein RAFTIN 1B OS=Triticum aestivum GN=RAFTIN1B... [more]
RAF1A_WHEAT3.400e-2445.28Protein RAFTIN 1A OS=Triticum aestivum GN=RAFTIN1A... [more]
BURPD_ORYSJ1.866e-2246.36BURP domain-containing protein 13 OS=Oryza sativa ... [more]
EA92_VICFA1.478e-1945.45Embryonic abundant protein USP92 OS=Vicia faba PE=... [more]
EA30_VICFA1.478e-1945.45Embryonic abundant protein VF30.1 OS=Vicia faba PE... [more]
SVF30_VICFA2.135e-1844.44Unknown seed protein 30.1 OS=Vicia faba PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01004G12SK Veg1 Citrus clementina cDNA clone C01004G12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287112 ID=CX287112|Name=CX287112|organism=Citrus clementina|type=EST|length=506bp
AGGAAGATAACTACTAGGCACACAAGTTTTGAAGTACAGCAAGCTTAATG
TATGCATAACAAATTGAACTGGGTATTCAAAGTAAATTATTGTACAACTA
AATGGATAACTGCTTGAACTGACTGATTCGAACTCTGCTGATTAAGTAGA
TGGGATAAGAGGATCAAATTCTATTCTCCAGTCTTCTTATTGGGAACCCA
GACAATGTGATCCTCAGGAAGGAAGTGACATATAGGAACAGTTCCTGGCT
TAACTTTGAGCACTTGAAAAGCTAAATGCTTGGGGTTCCATGCTGATGTA
TCTGTGTGGCAGACTGCTGCTGCTTTGGCTTTTGTCCCATCAACACCTTC
CAAGGGAACTATGTAAGCCCTTGTGGTTTGTGTTGCATGGCAGTAGAATA
CAGCATATGGATAGTTCTGCTTATGGCACACTACTGATTTGTCGGCTGCC
ATCTGCTTCACTCCAGCTGCGATTGTATATGTCTGCATCTTGGTTCCTTT
TTTTAC
back to top