CX287118

Overview
NameCX287118
Unique NameCX287118
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length508
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX287118 vs. ExPASy Swiss-Prot
Match: CATA1_GOSHI (Catalase isozyme 1 OS=Gossypium hirsutum GN=CAT1 PE=2 SV=2)

HSP 1 Score: 213.001 bits (541), Expect = 6.354e-55
Identity = 98/111 (88.29%), Postives = 102/111 (91.89%), Query Frame = -3
Query:  174 NFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI 506
            NFMHRDEEI+YFPSRYDPVRHAEM P PP +C GRREKCII KENNFKQPGERYRSWA DRQERFICRWVDALSDPRVTHEIR IWISYWSQA KS+GQKLAS LNVRP+I
Sbjct:  382 NFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASLLNVRPSI 492          
BLAST of CX287118 vs. ExPASy Swiss-Prot
Match: CATA3_NICPL (Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN=CAT3 PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 6.575e-52
Identity = 90/111 (81.08%), Postives = 100/111 (90.09%), Query Frame = -3
Query:  174 NFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI 506
            NFMHRDEE++YFPSR+DP RHAE +P PP +  G+R+KCII KENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIR IW SYWSQA K+LGQK+ASRLNVRP +
Sbjct:  382 NFMHRDEEVNYFPSRFDPCRHAEQYPIPPCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFSYWSQADKTLGQKIASRLNVRPTM 492          
BLAST of CX287118 vs. ExPASy Swiss-Prot
Match: CATA_SOLAP (Catalase OS=Soldanella alpina PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 8.587e-52
Identity = 89/111 (80.18%), Postives = 102/111 (91.89%), Query Frame = -3
Query:  174 NFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI 506
            NFMHRDEE++YFPSR+DPVRHAE HP PP +  G+R++C+I KENNFKQPGERYR++APDRQERF+CRWVDALSDPRVTHEIR IWISYW+QA KSLGQKLASRLNVRP +
Sbjct:  382 NFMHRDEEVNYFPSRFDPVRHAERHPIPPPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM 492          
BLAST of CX287118 vs. ExPASy Swiss-Prot
Match: CATA2_ARATH (Catalase-2 OS=Arabidopsis thaliana GN=CAT2 PE=1 SV=3)

HSP 1 Score: 201.445 bits (511), Expect = 1.913e-51
Identity = 89/111 (80.18%), Postives = 102/111 (91.89%), Query Frame = -3
Query:  174 NFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI 506
            NFMHRDEE++YFPSRYD VRHAE +PTPP +C G+RE+CII KENNFK+PGERYR++ P+RQERFI RW+DALSDPR+THEIR IWISYWSQA KSLGQKLASRLNVRP+I
Sbjct:  382 NFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI 492          
BLAST of CX287118 vs. ExPASy Swiss-Prot
Match: CATA4_SOYBN (Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 4.262e-51
Identity = 90/111 (81.08%), Postives = 98/111 (88.29%), Query Frame = -3
Query:  174 NFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI 506
            NF+HRDEE++YFPSRYDPVRHAE  P PP IC GRREKC I KENNFKQPGERYRSWAPDRQ+RF  RWVDALSDPRVTHEIR +WISYWSQA +SLGQK+AS L+ RPNI
Sbjct:  382 NFIHRDEEVNYFPSRYDPVRHAERFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSTRPNI 492          
BLAST of CX287118 vs. ExPASy Swiss-Prot
Match: CATA2_SOLLC (Catalase isozyme 2 OS=Solanum lycopersicum GN=CAT2 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 7.270e-51
Identity = 91/111 (81.98%), Postives = 101/111 (90.99%), Query Frame = -3
Query:  174 NFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI 506
            NFMHRDEEIDYFPSRYD VRHAE++P P  +C G+REKCII KENNFKQPGERYRS+ PDRQERFI RWV+ALSDPR+T+EIR IWI+YWSQA KSLGQKLASRLNVRP+I
Sbjct:  382 NFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI 492          
BLAST of CX287118 vs. ExPASy Swiss-Prot
Match: CATA1_NICPL (Catalase isozyme 1 (Fragment) OS=Nicotiana plumbaginifolia GN=CAT1 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 7.270e-51
Identity = 91/111 (81.98%), Postives = 100/111 (90.09%), Query Frame = -3
Query:  174 NFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI 506
            NFMHRDEEIDYFPSRYDPVRHAE +P P  +C G+REKC+I KENNFKQPGERYRS+ PDRQERFI RWV+ LSDPR+T+EIR IWISYWSQA KSLGQKLASRLNVRP+I
Sbjct:  375 NFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI 485          
BLAST of CX287118 vs. ExPASy Swiss-Prot
Match: CATA2_GOSHI (Catalase isozyme 2 OS=Gossypium hirsutum GN=CAT2 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 9.494e-51
Identity = 91/111 (81.98%), Postives = 100/111 (90.09%), Query Frame = -3
Query:  174 NFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI 506
            NFMHRDEE++YFPSRYDPVRHAE HP P  +  G+REKCII KENNFKQPGERYRS++ DRQERFI RW+DALSDPRVTHEIR IWISYWSQA KSLGQK+ASRLNVRP+I
Sbjct:  382 NFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI 492          
BLAST of CX287118 vs. ExPASy Swiss-Prot
Match: CATA1_CUCPE (Catalase isozyme 1 OS=Cucurbita pepo GN=CAT1 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.240e-50
Identity = 88/111 (79.28%), Postives = 99/111 (89.19%), Query Frame = -3
Query:  174 NFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI 506
            NFMHRDEE++YFPSR+DP RHAE +P PP +C G+RE+CII KENNFK+PGERYRSW PDRQERF+ RWVDALSD RVTHEIR IWISYWSQA +SLGQKLAS LNVRP+I
Sbjct:  382 NFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI 492          
BLAST of CX287118 vs. ExPASy Swiss-Prot
Match: CATA1_SOYBN (Catalase-1/2 OS=Glycine max GN=CAT1 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.620e-50
Identity = 89/111 (80.18%), Postives = 99/111 (89.19%), Query Frame = -3
Query:  174 NFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI 506
            NFMHRDEE++YFPSRYDPVRHAE  P PP I GG+REKC+I KENNFKQPGERYRSW  DRQERF+ RWVDALSDPRVTHEIR IWISYWSQA +SLGQK+AS LN++P+I
Sbjct:  382 NFMHRDEEVNYFPSRYDPVRHAEKVPVPPRILGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI 492          
The following BLAST results are available for this feature:
BLAST of CX287118 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
CATA1_GOSHI6.354e-5588.29Catalase isozyme 1 OS=Gossypium hirsutum GN=CAT1 P... [more]
CATA3_NICPL6.575e-5281.08Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN... [more]
CATA_SOLAP8.587e-5280.18Catalase OS=Soldanella alpina PE=2 SV=1[more]
CATA2_ARATH1.913e-5180.18Catalase-2 OS=Arabidopsis thaliana GN=CAT2 PE=1 SV... [more]
CATA4_SOYBN4.262e-5181.08Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1[more]
CATA2_SOLLC7.270e-5181.98Catalase isozyme 2 OS=Solanum lycopersicum GN=CAT2... [more]
CATA1_NICPL7.270e-5181.98Catalase isozyme 1 (Fragment) OS=Nicotiana plumbag... [more]
CATA2_GOSHI9.494e-5181.98Catalase isozyme 2 OS=Gossypium hirsutum GN=CAT2 P... [more]
CATA1_CUCPE1.240e-5079.28Catalase isozyme 1 OS=Cucurbita pepo GN=CAT1 PE=2 ... [more]
CATA1_SOYBN1.620e-5080.18Catalase-1/2 OS=Glycine max GN=CAT1 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01004H06SK Veg1 Citrus clementina cDNA clone C01004H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287118 ID=CX287118|Name=CX287118|organism=Citrus clementina|type=EST|length=508bp
GCATTTATTTTAAGGAACATCATGTTTATGAATTACAGGACCAACATGTT
TTTTTTAGTATTACAAAATAACACACCACCCGAAAACGAATTCGCATTCC
TTAAACTGCTGACGTCCTCTGTGTTTACTCCTTGCTAACTCTTTCTAAAT
CACTCAGCTCCGCATCACCATTAAATGTTAGGCCTCACATTCAGACGAGA
TGCCAACTTCTGACCCAGAGACTTGCAAGCCTGAGACCAGTATGAGATCC
ATATGTGGCGGATCTCATGGGTGACGCGTGGATCAGATAAAGCATCAACC
CATCTGCAGATGAATCGCTCTTGCCTGTCTGGTGCCCAAGATCGGTATCT
CTCTCCAGGTTGTTTGAAGTTGTTTTCCTTTGGAATTATGCACTTCTCGC
GCCTTCCGCCGCAGATTTCAGGAGGAGTTGGATGCATCTCAGCATGACGG
ACAGGATCATACCTTGAAGGGAAGTAATCGATCTCCTCATCCCTGTGCAT
GAAATTCA
back to top