CX287125

Overview
NameCX287125
Unique NameCX287125
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length502
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX287125_ssr296 microsatellite CX287125_ssr296:296..307. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CX287125 vs. ExPASy Swiss-Prot
Match: G3PC_PETCR (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petroselinum crispum GN=GAPC PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.354e-33
Identity = 67/88 (76.14%), Postives = 79/88 (89.77%), Query Frame = 2
Query:    5 RLAKGASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEHMALVA 268
            RL K A+Y+++KAAIK+ SE SLKGILGYT++DVVS DFVGDSRSSIFDAKAGI L+ +F+K+VSWYDNEWGYSNRV+DLI HMA VA
Sbjct:  249 RLEKAATYDEIKAAIKHESETSLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNGNFVKVVSWYDNEWGYSNRVIDLIRHMASVA 336          
BLAST of CX287125 vs. ExPASy Swiss-Prot
Match: G3PC_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic (Fragment) OS=Nicotiana tabacum GN=GAPC PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.017e-33
Identity = 69/88 (78.41%), Postives = 78/88 (88.64%), Query Frame = 2
Query:    5 RLAKGASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEHMALVA 268
            RL K ASY+D+KAAIK  SEG LKGILG+T++DVVS DFVGDSRSSIFDAKAGI LS +F+KLVSWYDNEWGYS+RV+DLI HMA VA
Sbjct:  239 RLEKEASYDDIKAAIKEESEGKLKGILGFTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVIDLICHMASVA 326          
BLAST of CX287125 vs. ExPASy Swiss-Prot
Match: G3PC_CRAPL (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Craterostigma plantagineum GN=GAPC PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.147e-32
Identity = 66/84 (78.57%), Postives = 76/84 (90.48%), Query Frame = 2
Query:    8 LAKGASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEHMA 259
            LAK ASY+++KAAIK  SEG LKGILGYT+EDVVS+DFVGDSRSSIFDAKAGI LS  F+K+V+WYDNEWGYS+RV+DLI HMA
Sbjct:  251 LAKEASYDEIKAAIKEESEGKLKGILGYTEEDVVSSDFVGDSRSSIFDAKAGIALSKKFVKIVAWYDNEWGYSSRVVDLIRHMA 334          
BLAST of CX287125 vs. ExPASy Swiss-Prot
Match: G3PC_MAIZE (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 1 OS=Zea mays GN=GAPC1 PE=2 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 1.497e-32
Identity = 65/84 (77.38%), Postives = 74/84 (88.10%), Query Frame = 2
Query:    5 RLAKGASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEHM 256
            R+ KGASYED+K AIK ASEG LKGI+GY +ED+VS DF+GDSRSSIFDAKAGI L+  F+KLVSWYDNEWGYSNRV+DLI HM
Sbjct:  250 RIEKGASYEDIKKAIKAASEGPLKGIMGYVEEDLVSTDFLGDSRSSIFDAKAGIALNDHFVKLVSWYDNEWGYSNRVVDLIRHM 333          
BLAST of CX287125 vs. ExPASy Swiss-Prot
Match: G3PC_GINBI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ginkgo biloba PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 3.336e-32
Identity = 65/85 (76.47%), Postives = 76/85 (89.41%), Query Frame = 2
Query:    5 RLAKGASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEHMA 259
            RL K ASY+++KAAIK  SEG LKGILGYT++DVVS DF+GD+RSSIFDAKAGI LS +F+KLVSWYDNEWGYS+RV+DLI HMA
Sbjct:  253 RLEKPASYDEIKAAIKEESEGKLKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSSRVIDLIVHMA 337          
BLAST of CX287125 vs. ExPASy Swiss-Prot
Match: G3P_ATRNU (Glyceraldehyde-3-phosphate dehydrogenase OS=Atriplex nummularia PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.357e-32
Identity = 66/98 (67.35%), Postives = 80/98 (81.63%), Query Frame = 2
Query:    5 RLAKGASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEHMALVAAHN*TVKLVC 298
            RL K A+YE +KAAIK  SEG +KGILGYT++DVVS DFVGD+RSSIFDAKAGI L+ +F+KLVSWYDNEWGYS+RV+DLI HM+   +   +V L C
Sbjct:  250 RLEKEATYEQIKAAIKEESEGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGICLNGNFVKLVSWYDNEWGYSSRVVDLIRHMSKTTSKLDSVALAC 347          
BLAST of CX287125 vs. ExPASy Swiss-Prot
Match: G3PX_HORVU (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Hordeum vulgare GN=GAPC PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.357e-32
Identity = 65/85 (76.47%), Postives = 73/85 (85.88%), Query Frame = 2
Query:    5 RLAKGASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEHMA 259
            R  K ASY+D+K AIK ASEG LKGI+GY +ED+VS DFVGDSRSSIFDAKAGI L+  F+KLVSWYDNEWGYSNRV+DLI HMA
Sbjct:  250 RTEKAASYDDIKKAIKAASEGKLKGIMGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDHFVKLVSWYDNEWGYSNRVVDLIRHMA 334          
BLAST of CX287125 vs. ExPASy Swiss-Prot
Match: G3PC_ANTMA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Antirrhinum majus GN=GAPC PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.357e-32
Identity = 67/87 (77.01%), Postives = 75/87 (86.21%), Query Frame = 2
Query:    5 RLAKGASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEHMALV 265
            RL K A+YE +KAAIK  SEG LKGILGYT++DVVS DFVGDSRSSIFDAKAGI L+ +F+KLVSWYDNEWGYS RV+DLI HMA V
Sbjct:  250 RLEKKATYEQIKAAIKEESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVVDLIVHMASV 336          
BLAST of CX287125 vs. ExPASy Swiss-Prot
Match: G3PD_MAIZE (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 2 OS=Zea mays GN=GAPC2 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 5.690e-32
Identity = 64/84 (76.19%), Postives = 73/84 (86.90%), Query Frame = 2
Query:    5 RLAKGASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEHM 256
            R+ KGASYE++K AIK ASEG LKGI+GY +ED+VS DF GDSRSSIFDAKAGI L+  F+KLVSWYDNEWGYSNRV+DLI HM
Sbjct:  250 RIEKGASYEEIKKAIKAASEGPLKGIMGYVEEDLVSTDFTGDSRSSIFDAKAGIALNDHFIKLVSWYDNEWGYSNRVVDLIRHM 333          
BLAST of CX287125 vs. ExPASy Swiss-Prot
Match: G3PC_ORYSJ (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Oryza sativa subsp. japonica GN=GAPC PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 9.706e-32
Identity = 63/85 (74.12%), Postives = 75/85 (88.24%), Query Frame = 2
Query:    5 RLAKGASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEHMA 259
            R+ K ASY+ +K+AIK ASEG LKGI+GY +ED+VS DFVGDSRSSIFDAKAGI L+ +F+KLV+WYDNEWGYSNRV+DLI HMA
Sbjct:  250 RIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMA 334          
The following BLAST results are available for this feature:
BLAST of CX287125 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 241
Match NameE-valueIdentityDescription
G3PC_PETCR1.354e-3376.14Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_TOBAC3.017e-3378.41Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_CRAPL1.147e-3278.57Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_MAIZE1.497e-3277.38Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_GINBI3.336e-3276.47Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3P_ATRNU4.357e-3267.35Glyceraldehyde-3-phosphate dehydrogenase OS=Atripl... [more]
G3PX_HORVU4.357e-3276.47Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ANTMA4.357e-3277.01Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PD_MAIZE5.690e-3276.19Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ORYSJ9.706e-3274.12Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01005A02SK Veg1 Citrus clementina cDNA clone C01005A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287125 ID=CX287125|Name=CX287125|organism=Citrus clementina|type=EST|length=502bp
TTGTCGACTTGCAAAGGGTGCTTCCTATGAAGATGTCAAAGCCGCCATAA
AGTATGCATCGGAGGGTTCACTGAAAGGCATTCTTGGATACACAGATGAG
GATGTTGTCTCTAATGACTTTGTTGGAGACTCGAGGTCAAGTATATTTGA
TGCGAAGGCTGGGATTGGATTGAGTGCATCCTTCATGAAGCTTGTGTCAT
GGTACGACAACGAGTGGGGATACAGCAATCGAGTGTTGGACCTCATCGAG
CACATGGCATTGGTAGCGGCCCACAACTAAACAGTAAAATTGGTTTGCTG
CTGCTGCAATTTTAGTGCATGCTTTTGGGTTAGATTGAAAGAGTAGTTAA
AAATTTGATAGTGATTCTGCGTTTTGTTCTGAGTGACTCGCAATATGAAC
TTTGGACATCCCTTGATGCAAATTTTAAAATAATGGAATAGAATATTCAA
AGTGTATGGAGTTCATTCCACTACTACCATCTTTGTTTGGATTCTGGGCA
TC
back to top