CX287132

Overview
NameCX287132
Unique NameCX287132
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length628
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX287132_ssr121 microsatellite CX287132_ssr121:121..132. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CX287132 vs. ExPASy Swiss-Prot
Match: EKIA_DICDI (Probable ethanolamine kinase A OS=Dictyostelium discoideum GN=etnkA PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.335e-14
Identity = 42/127 (33.07%), Postives = 67/127 (52.76%), Query Frame = 2
Query:  200 DSRFSVDTVSGGITNLLLKVTVK--EESGNDVSVTVRLYGPNTDIVINRQRELQAIKYLSAAGFGAKLLAVFGNGMVQSFINARTLTPADMRNPKLAAEIAKQLRRFHQVEIPGSKEPQLWNDVSKF 574
            D   ++  ++GGITN+L  V  K  E+    + V +RLYG  ++ +I+R+ EL         G GAK   +F NG +  FI    L   D+  P +   IAK++ ++H +E+P  K P LW  + K+
Sbjct:   41 DEDLTIQKLNGGITNVLYLVEDKNIEQKYRYLPVVIRLYGYKSEEIIDRKNELIIQTEADQNGLGAKFYGLFDNGCIYGFIKGEPLAYEDISKPTMQTCIAKEIAQWHSIEMPTRKNPSLWPTIKKW 167          
BLAST of CX287132 vs. ExPASy Swiss-Prot
Match: KICH_YEAST (Choline kinase OS=Saccharomyces cerevisiae GN=CKI1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.078e-11
Identity = 49/155 (31.61%), Postives = 81/155 (52.26%), Query Frame = 2
Query:   83 STEFLSSPLI---VDTSLSLPLMTPRVIALCKDL-FKQW---SKLDDSRFSVDTV--SGGITNLLLKVTVKEESGNDVSVTVRLYGPNTDIVINRQRELQAIKYLSAAGFGAKLLAVFGNGMVQSFI-NARTLTPADMRNPKLAAEIAKQLRRFH 517
            S+E++  P +   +D SL    +   ++ L + L   +W    K+      ++ V  SG +TN + KV    E     S+ +R+YGPN D +I+R+ ELQ +  LS    G  L   F NG  + F+ N++TLT  D+RN K +  IA++++  H
Sbjct:   97 SSEYIEIPFVKETLDASLPSDYLKQDILNLIQSLKISKWYNNKKIQPVAQDMNLVKISGAMTNAIFKV----EYPKLPSLLLRIYGPNIDNIIDREYELQILARLSLKNIGPSLYGCFVNGRFEQFLENSKTLTKDDIRNWKNSQRIARRMKELH 247          
BLAST of CX287132 vs. ExPASy Swiss-Prot
Match: CHKB_RAT (Choline/ethanolamine kinase OS=Rattus norvegicus GN=Chkb PE=1 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 3.078e-11
Identity = 42/152 (27.63%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  185 WSKLDDSRFSVDTVSGGITNLLLKVT----VKEESGNDVSVTVRLYGPNTDIVINRQRELQAIKYLSAAGFGAKLLAVFGNGMVQSFINARTLTPADMRNPKLAAEIAKQLRRFHQVEIPGSKEPQ-LWNDVSKFFEKASSLKFDEIEKQSM 625
            W +      SV  VSGG++NLL + +    V    G    V +RLYG     V +   E      L+    G +L  VF  G ++ ++ +R L   ++R+P L+  IA ++ RFH +E+P +KEP+ L+  + ++ ++   L    + + ++
Sbjct:   61 WRRARPEELSVCPVSGGLSNLLFRCSLPNHVPSMGGEPREVLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYLPSRPLKTQELRDPVLSGAIATKMARFHGMEMPFTKEPRWLFGTMERYLKQIQDLPSTSLPQMNL 212          
BLAST of CX287132 vs. ExPASy Swiss-Prot
Match: CHKB_MOUSE (Choline/ethanolamine kinase OS=Mus musculus GN=Chkb PE=1 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 3.078e-11
Identity = 42/152 (27.63%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  185 WSKLDDSRFSVDTVSGGITNLLLKVT----VKEESGNDVSVTVRLYGPNTDIVINRQRELQAIKYLSAAGFGAKLLAVFGNGMVQSFINARTLTPADMRNPKLAAEIAKQLRRFHQVEIPGSKEPQ-LWNDVSKFFEKASSLKFDEIEKQSM 625
            W +      SV  VSGG++NLL + +    V    G    V +RLYG     V +   E      L+    G +L  VF  G ++ ++ +R L   ++R+P L+  IA ++ RFH +E+P +KEP+ L+  + ++ ++   L    + + ++
Sbjct:   61 WRRARPEELSVCPVSGGLSNLLFRCSLPNHVPSVGGEPREVLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYLPSRPLKTQELRDPVLSGAIATRMARFHGMEMPFTKEPRWLFGTMERYLKQIQDLPSTSLPQMNL 212          
BLAST of CX287132 vs. ExPASy Swiss-Prot
Match: EKI1_MOUSE (Ethanolamine kinase 1 (Fragment) OS=Mus musculus GN=Etnk1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.019e-11
Identity = 43/143 (30.07%), Postives = 71/143 (49.65%), Query Frame = 2
Query:  155 IALCKDLFKQWSKLDDSRFSVDTVSGGITNLLLKVTVKEESGNDVSVTVRLYGPNTDIVINRQRELQAIKYLSAAGFGAKLLAVFGNGMVQSFINARTLTPADMRNPKLAAEIAKQLRRFHQVEIPGSKEPQ--LWNDVSKFF 577
            ++L + L   W   D    ++   + GITN L+   V +    DV V VR+YG  T+++++R  E+++ + L A G   +L   F NG+   FI    L P  + NP +   IA+QL + H +       P+  LW  + K+F
Sbjct:   83 LSLLRHLRPHW---DPREVTLQLFTDGITNKLIACYVGDTM-EDV-VLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGELLDPQHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYF 220          
BLAST of CX287132 vs. ExPASy Swiss-Prot
Match: EKI1_HUMAN (Ethanolamine kinase 1 OS=Homo sapiens GN=ETNK1 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.019e-11
Identity = 43/145 (29.66%), Postives = 71/145 (48.97%), Query Frame = 2
Query:  155 IALCKDLFKQWSKLDDSRFSVDTVSGGITNLLLKVTVKEESGNDVS--VTVRLYGPNTDIVINRQRELQAIKYLSAAGFGAKLLAVFGNGMVQSFINARTLTPADMRNPKLAAEIAKQLRRFHQVEIPGSKEPQ--LWNDVSKFF 577
            ++L + L   W   D    ++   + GITN L+   V    GN +   V VR+YG  T+++++R  E+++ + L A G   +L   F NG+   FI    L P  + NP +   IA+QL + H +       P+  LW  + K+F
Sbjct:  123 LSLLQHLRPHW---DPQEVTLQLFTDGITNKLIGCYV----GNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYF 260          
BLAST of CX287132 vs. ExPASy Swiss-Prot
Match: EKI2_HUMAN (Ethanolamine kinase 2 OS=Homo sapiens GN=ETNK2 PE=2 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 6.856e-11
Identity = 40/145 (27.59%), Postives = 72/145 (49.66%), Query Frame = 2
Query:  146 PRVIALCKDLFKQWSKLDDSRFSVDTVSGGITNLLLKVTVKEESGNDVSVTVRLYGPNTDIVINRQRELQAIKYLSAAGFGAKLLAVFGNGMVQSFINARTLTPADMRNPKLAAEIAKQLRRFHQVEIPGS-KEPQLWNDVSKFF 577
            P  + L ++L   W      +      + GITN L+   V+E+  +   V VR+YG  T+++++R+ E++  + L A     KL   F NG+   ++    L P  +R P+L   IA ++ + H +   GS  +P LW+ +  +F
Sbjct:   65 PGALRLIQELRPHWKP---EQVRTKRFTDGITNKLVACYVEEDMQD--CVLVRVYGERTELLVDRENEVRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIALEMAKIHTIHANGSLPKPILWHKMHNYF 204          
The following BLAST results are available for this feature:
BLAST of CX287132 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
EKIA_DICDI1.335e-1433.07Probable ethanolamine kinase A OS=Dictyostelium di... [more]
KICH_YEAST3.078e-1131.61Choline kinase OS=Saccharomyces cerevisiae GN=CKI1... [more]
CHKB_RAT3.078e-1127.63Choline/ethanolamine kinase OS=Rattus norvegicus G... [more]
CHKB_MOUSE3.078e-1127.63Choline/ethanolamine kinase OS=Mus musculus GN=Chk... [more]
EKI1_MOUSE4.019e-1130.07Ethanolamine kinase 1 (Fragment) OS=Mus musculus G... [more]
EKI1_HUMAN4.019e-1129.66Ethanolamine kinase 1 OS=Homo sapiens GN=ETNK1 PE=... [more]
EKI2_HUMAN6.856e-1127.59Ethanolamine kinase 2 OS=Homo sapiens GN=ETNK2 PE=... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01005A10SK Veg1 Citrus clementina cDNA clone C01005A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287132 ID=CX287132|Name=CX287132|organism=Citrus clementina|type=EST|length=628bp
GTTCGATAAAGAAGCGGAAATGGGAGCAGCGAAGAAGATCTGGAACGAAA
TGGAGGTTGCAGCCGAAGCTCGTGAGAACGGCAGCACTGAATTCCTATCA
TCTCCTCTCATCGTCGACACCTCTCTCTCTCTTCCTCTCATGACCCCTCG
CGTCATTGCCTTGTGCAAGGATCTGTTCAAGCAGTGGTCAAAGTTGGACG
ATTCTCGTTTCTCTGTGGATACAGTATCCGGAGGAATTACAAATCTGCTT
TTGAAGGTTACTGTGAAGGAAGAAAGTGGAAATGATGTTTCTGTGACCGT
TAGATTGTATGGGCCCAACACTGATATTGTTATCAATCGTCAGCGGGAAT
TGCAGGCCATCAAATACCTCTCGGCTGCAGGCTTTGGAGCGAAGTTGCTT
GCGGTTTTTGGAAATGGCATGGTGCAATCTTTTATTAATGCGCGTACTTT
AACTCCGGCAGACATGAGAAATCCAAAGCTGGCTGCCGAAATTGCCAAAC
AACTGCGCAGATTCCATCAAGTGGAAATTCCTGGTTCTAAAGAACCTCAA
TTATGGAATGATGTCTCCAAGTTTTTTGAGAAAGCATCTTCCCTTAAATT
TGATGAGATTGAGAAGCAGAGTATGTAT
back to top