CX287174

Overview
NameCX287174
Unique NameCX287174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length581
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX287174_ssr237 microsatellite CX287174_ssr237:237..248. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CX287174 vs. ExPASy Swiss-Prot
Match: CKS1_ORYSJ (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. japonica GN=CKS1 PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 5.227e-36
Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 3
Query:   18 MGQIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 230
            MGQIQYSEKYFDDTYEYRHVVLPP+VAKLLPKNRLLSE EWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL
Sbjct:    1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 71          
BLAST of CX287174 vs. ExPASy Swiss-Prot
Match: CKS1_ORYSI (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. indica GN=CKS1 PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 5.227e-36
Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 3
Query:   18 MGQIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 230
            MGQIQYSEKYFDDTYEYRHVVLPP+VAKLLPKNRLLSE EWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL
Sbjct:    1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 71          
BLAST of CX287174 vs. ExPASy Swiss-Prot
Match: CKS1_ARATH (Cyclin-dependent kinases regulatory subunit 1 OS=Arabidopsis thaliana GN=CKS1 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.986e-35
Identity = 67/71 (94.37%), Postives = 70/71 (98.59%), Query Frame = 3
Query:   18 MGQIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 230
            MGQIQYSEKYFDDT+EYRHVVLPP+VAKLLPKNRLLSE EWRAIGVQQSRGWVHYA+HRPEPHIMLFRRPL
Sbjct:    1 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAVHRPEPHIMLFRRPL 71          
BLAST of CX287174 vs. ExPASy Swiss-Prot
Match: CKS2_ARATH (Cyclin-dependent kinases regulatory subunit 2 OS=Arabidopsis thaliana GN=CKS2 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 4.425e-35
Identity = 66/71 (92.96%), Postives = 71/71 (100.00%), Query Frame = 3
Query:   18 MGQIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 230
            MGQIQYS+KYFDDT+EYRHVVLPP+VAKLLPKNR+LSE+EWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL
Sbjct:    1 MGQIQYSDKYFDDTFEYRHVVLPPEVAKLLPKNRILSESEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 71          
BLAST of CX287174 vs. ExPASy Swiss-Prot
Match: CKS1_PHYPO (Probable cyclin-dependent kinases regulatory subunit OS=Physarum polycephalum PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.056e-28
Identity = 54/66 (81.82%), Postives = 62/66 (93.94%), Query Frame = 3
Query:   27 IQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR 224
            IQYSEKY+DD +EYRHV+LPPDVAK +PKNRLLSE EWR +GVQQS+GWVHYA+HRPEPHI+LFRR
Sbjct:    6 IQYSEKYYDDKFEYRHVILPPDVAKEIPKNRLLSEGEWRGLGVQQSQGWVHYALHRPEPHILLFRR 71          
BLAST of CX287174 vs. ExPASy Swiss-Prot
Match: CKS1_MOUSE (Cyclin-dependent kinases regulatory subunit 1 OS=Mus musculus GN=Cks1b PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.864e-25
Identity = 49/69 (71.01%), Postives = 60/69 (86.96%), Query Frame = 3
Query:   24 QIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 230
            QI YS+KY D+ +EYRHV+LP D+AKL+PK  L+SE+EWR +GVQQS+GWVHY IH PEPHI+LFRRPL
Sbjct:    5 QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL 73          
BLAST of CX287174 vs. ExPASy Swiss-Prot
Match: CKS1_HUMAN (Cyclin-dependent kinases regulatory subunit 1 OS=Homo sapiens GN=CKS1B PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.864e-25
Identity = 49/69 (71.01%), Postives = 60/69 (86.96%), Query Frame = 3
Query:   24 QIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 230
            QI YS+KY D+ +EYRHV+LP D+AKL+PK  L+SE+EWR +GVQQS+GWVHY IH PEPHI+LFRRPL
Sbjct:    5 QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL 73          
BLAST of CX287174 vs. ExPASy Swiss-Prot
Match: CKS1_BOVIN (Cyclin-dependent kinases regulatory subunit 1 OS=Bos taurus GN=CKS1B PE=3 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.864e-25
Identity = 49/69 (71.01%), Postives = 60/69 (86.96%), Query Frame = 3
Query:   24 QIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 230
            QI YS+KY D+ +EYRHV+LP D+AKL+PK  L+SE+EWR +GVQQS+GWVHY IH PEPHI+LFRRPL
Sbjct:    5 QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL 73          
BLAST of CX287174 vs. ExPASy Swiss-Prot
Match: CKS1_PATVU (Cyclin-dependent kinases regulatory subunit OS=Patella vulgata PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 4.152e-25
Identity = 47/67 (70.15%), Postives = 58/67 (86.57%), Query Frame = 3
Query:   24 QIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR 224
            QI YS+KYFD+ +EYRHV+LP D+AK++PKN L+SE EWR+IGVQQS GW+HY  H PEPHI+LFRR
Sbjct:    5 QIYYSDKYFDEDFEYRHVMLPKDIAKMVPKNHLMSEAEWRSIGVQQSHGWIHYMKHEPEPHILLFRR 71          
BLAST of CX287174 vs. ExPASy Swiss-Prot
Match: CKS1_LEIME (Cyclin-dependent kinases regulatory subunit OS=Leishmania mexicana PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 7.082e-25
Identity = 45/68 (66.18%), Postives = 61/68 (89.71%), Query Frame = 3
Query:   24 QIQYSEKYFDDTYEYRHVVLPPDVAKLLPKNRLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRP 227
            +I YS+KY+DD +EYRHV+LP D+A+L+P +RL+SE EWR +GVQQS+GWVHY IH+PEPH++LF+RP
Sbjct:   30 KILYSDKYYDDMFEYRHVILPKDLARLVPTSRLMSEMEWRQLGVQQSQGWVHYMIHKPEPHVLLFKRP 97          
The following BLAST results are available for this feature:
BLAST of CX287174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
CKS1_ORYSJ5.227e-3697.18Cyclin-dependent kinases regulatory subunit 1 OS=O... [more]
CKS1_ORYSI5.227e-3697.18Cyclin-dependent kinases regulatory subunit 1 OS=O... [more]
CKS1_ARATH1.986e-3594.37Cyclin-dependent kinases regulatory subunit 1 OS=A... [more]
CKS2_ARATH4.425e-3592.96Cyclin-dependent kinases regulatory subunit 2 OS=A... [more]
CKS1_PHYPO1.056e-2881.82Probable cyclin-dependent kinases regulatory subun... [more]
CKS1_MOUSE1.864e-2571.01Cyclin-dependent kinases regulatory subunit 1 OS=M... [more]
CKS1_HUMAN1.864e-2571.01Cyclin-dependent kinases regulatory subunit 1 OS=H... [more]
CKS1_BOVIN1.864e-2571.01Cyclin-dependent kinases regulatory subunit 1 OS=B... [more]
CKS1_PATVU4.152e-2570.15Cyclin-dependent kinases regulatory subunit OS=Pat... [more]
CKS1_LEIME7.082e-2566.18Cyclin-dependent kinases regulatory subunit OS=Lei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01005E06SK Veg1 Citrus clementina cDNA clone C01005E06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287174 ID=CX287174; Name=CX287174; organism=Citrus clementina; type=EST; length=581bp
AGAAAATCGAGTGAAAAATGGGTCAGATCCAGTACTCGGAGAAATACTTC
GATGACACTTACGAGTACAGACACGTGGTTCTTCCTCCTGATGTGGCAAA
ATTGCTTCCCAAGAATCGTCTCCTTTCTGAAACTGAATGGCGTGCAATTG
GAGTTCAGCAGAGCCGTGGATGGGTTCACTATGCCATTCATCGTCCTGAA
CCACACATTATGCTCTTCCGCAGGCCTCTGAACTATCAGCAGCAGCAGGA
GAATCAAGCTCAGCAAAACATACTTGCCAAGTGATTTCACGTCGCTCTTT
ATGTCAAAGAATGGAAGGAATAGGAAGTTTAGTGTTTTACCTAAAGGGTT
TAAATGTCGTAGGATGTTTGGTACTGCATTGTATCTCTATACATGCAGAA
TTCCATGTTAGGCTTCGTTTGGTGAATGGATGTGTTGTTGACATCTTTGA
TGTCTTTGTTGCTGCCTGTTTAGATATGTGATGTTGATACTTCTTGTGTA
CTGCTTGTGGATGAAAAGGCACCGGTGAATTCTGAGTGATTAAGCTTTTA
GTTGTCTTCTCAAAAAAAAAAAAAAAAAAAA
back to top