CX287263

Overview
NameCX287263
Unique NameCX287263
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length544
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13920 contig Ccv1_Contig13920:967..1510. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287263 vs. ExPASy Swiss-Prot
Match: ORYA_ORYSJ (Oryzain alpha chain OS=Oryza sativa subsp. japonica GN=Os04g0650000 PE=1 SV=2)

HSP 1 Score: 249.595 bits (636), Expect = 7.088e-66
Identity = 105/161 (65.22%), Postives = 123/161 (76.40%), Query Frame = 3
Query:    3 TSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASYXXXXXXXXXXXXXXXXXXXXXXAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKP 485
            T+LDHGV AVGYGTENG DYWIV+NSWG SWGE GY+RMERN+  + +GKCGIA+E SY                       VCDNYY+CP+S TCCC++EYG  C+AWGCCPLE ATCCDDHYSCCPH+YPICNV+ GTCLM+KD+PL V+AL+RT AKP
Sbjct:  285 TALDHGVAAVGYGTENGKDYWIVRNSWGKSWGESGYVRMERNIKAS-SGKCGIAVEPSYPLKKGENPPNPGPTPPSPTPPPTVCDNYYTCPDSTTCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVKALKRTLAKP 444          
BLAST of CX287263 vs. ExPASy Swiss-Prot
Match: RD21A_ARATH (Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 2.693e-65
Identity = 103/168 (61.31%), Postives = 125/168 (74.40%), Query Frame = 3
Query:    3 TSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASYXXXXXXXXXXXXXXXXXXXXXXAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYWAHGNQ 506
            T LDHGV AVGYGTENG DYWIV+NSWG SWGE GY+RM RN+A + +GKCGIA+E SY                        CD+YY+CPESNTCCC+FEYG  CFAWGCCPLEAATCCDD+YSCCPH+YP+C++  GTCL+SK++P  V+AL+R PA P+W+ G +
Sbjct:  293 TQLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLRMARNIASS-SGKCGIAIEPSYPIKNGENPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKALKRKPATPFWSQGRK 459          
BLAST of CX287263 vs. ExPASy Swiss-Prot
Match: CYSPL_SOLLC (Low-temperature-induced cysteine proteinase (Fragment) OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.935e-55
Identity = 92/169 (54.44%), Postives = 114/169 (67.46%), Query Frame = 3
Query:    3 TSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASYXXXXXXXXXXXXXXXXXXXXXXAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYWAHGNQG 509
            T++DHGV   GYGTENG DYWIV+NSWG++  E GY+R++RNV+ + +G CG+A+E SY                        CD Y  C    TCCC+ ++  SCF+WGCCPLE ATCC+DHYSCCPHDYPICNVR GTC MSK NPLGV+A++R  A+P  A GN G
Sbjct:  174 TAVDHGVVIAGYGTENGMDYWIVRNSWGANCRENGYLRVQRNVSSS-SGLCGLAIEPSYPVKTGPNPPKPAPSPPSPVKPPTECDEYSQCAVGTTCCCILQFRRSCFSWGCCPLEGATCCEDHYSCCPHDYPICNVRQGTCSMSKGNPLGVKAMKRILAQPIGAFGNGG 341          
BLAST of CX287263 vs. ExPASy Swiss-Prot
Match: ORYB_ORYSJ (Oryzain beta chain OS=Oryza sativa subsp. japonica GN=Os04g0670200 PE=1 SV=2)

HSP 1 Score: 211.075 bits (536), Expect = 2.794e-54
Identity = 96/166 (57.83%), Postives = 110/166 (66.27%), Query Frame = 3
Query:    3 TSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASYXXXXXXXXXXXXXXXXXXXXXXA------VCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAK 482
            TSLDHGV AVGYGT+NG DYWIV+NSWG  WGE GY+RMERN+  T TGKCGIAM ASY                             VCD+ +SCP  +TCCC F + N C  WGCCP+E ATCC DH SCCP DYP+CN RAGTC  SK++PL V+AL+RT AK
Sbjct:  298 TSLDHGVVAVGYGTDNGKDYWIVRNSWGPKWGESGYVRMERNINVT-TGKCGIAMMASYPTKSGANPPKPSPTPPTPPTPPPPSAPDHVCDDNFSCPAGSTCCCAFGFRNLCLVWGCCPVEGATCCKDHASCCPPDYPVCNTRAGTCSASKNSPLSVKALKRTLAK 462          
BLAST of CX287263 vs. ExPASy Swiss-Prot
Match: CYSP1_ORYSJ (Cysteine protease 1 OS=Oryza sativa subsp. japonica GN=CP1 PE=2 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 1.176e-44
Identity = 84/167 (50.30%), Postives = 97/167 (58.08%), Query Frame = 3
Query:    3 TSLDHGVTAVGYGTE--NGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASYXXXXXXXXXXXXXXXXXXXXXXAVCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRA----LRRTPAKP 485
            T+LDHGV AVGYGT+   GA YW V+NSWG  WGE GYIRMERNV    TGKCGIAM ASY                        CD Y  CP   TCCC +   N C  WGCCP+E ATCC DH +CCP +YP+CN +A TC  SK++P  +R      R  P +P
Sbjct:  313 TNLDHGVVAVGYGTDAATGAAYWTVRNSWGPDWGENGYIRMERNVTAR-TGKCGIAMMASYPIKKGPNPKPSPPSPAPSPPQQ--CDRYSKCPAGTTCCCNYGIRNHCIVWGCCPVEGATCCKDHSTCCPKEYPVCNAKARTCSKSKNSPYNIRTPAAMARSVPEQP 476          
BLAST of CX287263 vs. ExPASy Swiss-Prot
Match: GCP1_ARATH (Germination-specific cysteine protease 1 OS=Arabidopsis thaliana GN=GCP1 PE=2 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 1.072e-21
Identity = 44/59 (74.58%), Postives = 51/59 (86.44%), Query Frame = 3
Query:    3 TSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 179
            T+LDH V AVGYG+ENG DYWIV+NSWG  WGE GYIRMERN+A + +GKCGIA+EASY
Sbjct:  301 TNLDHAVVAVGYGSENGVDYWIVRNSWGPRWGEEGYIRMERNLAASKSGKCGIAVEASY 359          
BLAST of CX287263 vs. ExPASy Swiss-Prot
Match: CYSP4_BRANA (Cysteine proteinase COT44 (Fragment) OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 9.071e-21
Identity = 44/59 (74.58%), Postives = 52/59 (88.14%), Query Frame = 3
Query:    3 TSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 179
            T++DH V AVGYG+ENG DYWIV+NSWG+ WGE GYIRMERNVA + +GKCGIA+EASY
Sbjct:  256 TNMDHAVVAVGYGSENGVDYWIVRNSWGTRWGEDGYIRMERNVA-SKSGKCGIAIEASY 313          
BLAST of CX287263 vs. ExPASy Swiss-Prot
Match: CPR4_ARATH (Probable cysteine proteinase At4g11320 OS=Arabidopsis thaliana GN=At4g11320 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.731e-17
Identity = 40/59 (67.80%), Postives = 46/59 (77.97%), Query Frame = 3
Query:    3 TSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 179
            T+L+HGV  VGYGTENG DYWIVKNS G +WGE GY++M RN+A    G CGIAM ASY
Sbjct:  300 TNLNHGVVVVGYGTENGRDYWIVKNSRGDTWGEAGYMKMARNIANP-RGLCGIAMRASY 357          
BLAST of CX287263 vs. ExPASy Swiss-Prot
Match: CYSP_HEMSP (Thiol protease SEN102 OS=Hemerocallis sp. GN=SEN102 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.567e-17
Identity = 41/60 (68.33%), Postives = 45/60 (75.00%), Query Frame = 3
Query:    3 TSLDHGVTAVGYG-TENGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 179
            T LDHGV  VGYG T +G  YWIVKNSWG  WGE GYIRM+R ++    GKCGIAMEASY
Sbjct:  285 TELDHGVAIVGYGATRDGTKYWIVKNSWGEEWGESGYIRMQRGISDK-RGKCGIAMEASY 343          
BLAST of CX287263 vs. ExPASy Swiss-Prot
Match: CPR3_ARATH (Probable cysteine proteinase At4g11310 OS=Arabidopsis thaliana GN=At4g11310 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.947e-17
Identity = 39/59 (66.10%), Postives = 46/59 (77.97%), Query Frame = 3
Query:    3 TSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 179
            T+L+HGV  VGYGTENG DYW+VKNS G +WGE GY++M RN+A    G CGIAM ASY
Sbjct:  293 TNLNHGVVVVGYGTENGRDYWLVKNSRGITWGEAGYMKMARNIANP-RGLCGIAMRASY 350          
The following BLAST results are available for this feature:
BLAST of CX287263 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
ORYA_ORYSJ7.088e-6665.22Oryzain alpha chain OS=Oryza sativa subsp. japonic... [more]
RD21A_ARATH2.693e-6561.31Cysteine proteinase RD21a OS=Arabidopsis thaliana ... [more]
CYSPL_SOLLC1.935e-5554.44Low-temperature-induced cysteine proteinase (Fragm... [more]
ORYB_ORYSJ2.794e-5457.83Oryzain beta chain OS=Oryza sativa subsp. japonica... [more]
CYSP1_ORYSJ1.176e-4450.30Cysteine protease 1 OS=Oryza sativa subsp. japonic... [more]
GCP1_ARATH1.072e-2174.58Germination-specific cysteine protease 1 OS=Arabid... [more]
CYSP4_BRANA9.071e-2174.58Cysteine proteinase COT44 (Fragment) OS=Brassica n... [more]
CPR4_ARATH2.731e-1767.80Probable cysteine proteinase At4g11320 OS=Arabidop... [more]
CYSP_HEMSP3.567e-1768.33Thiol protease SEN102 OS=Hemerocallis sp. GN=SEN10... [more]
CPR3_ARATH7.947e-1766.10Probable cysteine proteinase At4g11310 OS=Arabidop... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01006F02SK Veg1 Citrus clementina cDNA clone C01006F02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287263 ID=CX287263|Name=CX287263|organism=Citrus clementina|type=EST|length=544bp
GGACATCTCTGGACCATGGTGTTACTGCTGTTGGATATGGCACAGAAAAT
GGAGCTGATTACTGGATTGTGAAGAATTCATGGGGCAGTAGCTGGGGAGA
GGGTGGCTATATTAGGATGGAGCGTAACGTGGCTGGCACTCTCACGGGCA
AGTGTGGAATTGCCATGGAGGCCTCATATCCCATAAAGAAAGGCCAAAAT
CCTCCCAACCCCGGACCGTCTCCTCCATCTCCAACAAAGCCTCCTGCTGT
GTGTGACAATTATTACTCTTGCCCTGAGAGCAACACTTGCTGCTGTGTCT
TTGAGTATGGTAACTCTTGCTTTGCATGGGGATGCTGCCCGCTTGAGGCT
GCCACCTGCTGTGATGACCACTATAGCTGCTGCCCACATGACTATCCCAT
CTGTAATGTTCGTGCTGGGACCTGCTTGATGAGCAAGGACAACCCATTGG
GAGTGAGGGCATTGCGACGCACCCCTGCTAAACCTTACTGGGCTCATGGA
AATCAAGGTGGAAGTAGCAGTGCTTAATTATAGTTGGCACTGTA
back to top