CX287267

Overview
NameCX287267
Unique NameCX287267
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length586
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3373 contig Ccv1_Contig3373:224..809. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287267 vs. ExPASy Swiss-Prot
Match: PLAS_SOLLC (Plastocyanin, chloroplastic OS=Solanum lycopersicum GN=PETE PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.873e-49
Identity = 93/109 (85.32%), Postives = 103/109 (94.50%), Query Frame = -3
Query:  255 SAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 581
            SAMLASNAMA+EVLLGGDDGSLAF+P +FSVS+GEKI FKNNAGFPHNVVFDEDEIP+GVD SKISMS EDLLN  GETY+VTL+EKGTY+FYC+PHQGAGMVG+VTVN
Sbjct:   62 SAMLASNAMALEVLLGGDDGSLAFIPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAGVDASKISMSEEDLLNAAGETYSVTLSEKGTYTFYCAPHQGAGMVGKVTVN 170          
BLAST of CX287267 vs. ExPASy Swiss-Prot
Match: PLAS_SPIOL (Plastocyanin, chloroplastic OS=Spinacia oleracea GN=PETE PE=1 SV=2)

HSP 1 Score: 192.586 bits (488), Expect = 1.214e-48
Identity = 92/110 (83.64%), Postives = 100/110 (90.91%), Query Frame = -3
Query:  255 ASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 584
            A+ +LA NAMA+EVLLGG DGSLAF+P  FSV+SGE+IVFKNNAGFPHNVVFDEDEIPSGVD +KISMS EDLLN PGETY VTLTEKGTY FYCSPHQGAGMVG+VTVN
Sbjct:   59 AAGLLAGNAMAVEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN 168          
BLAST of CX287267 vs. ExPASy Swiss-Prot
Match: PLAS1_POPNI (Plastocyanin A, chloroplastic OS=Populus nigra GN=PETE PE=1 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 2.991e-47
Identity = 91/110 (82.73%), Postives = 98/110 (89.09%), Query Frame = -3
Query:  255 ASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 584
            ASAM+ASNAMAI+VLLG DDGSLAFVPS FS+S GEKIVFKNNAGFPHN+VFDED IPSGVD SKISMS EDLLN  GET+ V L+ KG YSFYCSPHQGAGMVG+VTVN
Sbjct:   59 ASAMIASNAMAIDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN 168          
BLAST of CX287267 vs. ExPASy Swiss-Prot
Match: PLAS2_ARATH (Plastocyanin major isoform, chloroplastic OS=Arabidopsis thaliana GN=DRT112 PE=1 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 8.701e-47
Identity = 89/110 (80.91%), Postives = 98/110 (89.09%), Query Frame = -3
Query:  255 ASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 584
            AS  LA NAMAIEVLLGG DGSLAF+P+ FS++ GEKIVFKNNAG+PHNVVFDEDEIPSGVDV+KISM  +DLLNG GETY V LTE GTYSFYC+PHQGAGMVG+VTVN
Sbjct:   58 ASIALAGNAMAIEVLLGGGDGSLAFIPNDFSIAKGEKIVFKNNAGYPHNVVFDEDEIPSGVDVAKISMDEQDLLNGAGETYEVALTEPGTYSFYCAPHQGAGMVGKVTVN 167          
BLAST of CX287267 vs. ExPASy Swiss-Prot
Match: PLAS_PEA (Plastocyanin, chloroplastic OS=Pisum sativum GN=PETE PE=4 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 2.532e-46
Identity = 90/110 (81.82%), Postives = 96/110 (87.27%), Query Frame = -3
Query:  255 ASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 584
            ASA+LASNA+A+EVLLG  DG LAFVPSS  VS+GE IVFKNNAGFPHNVVFDEDEIP+GVD SKISM  EDLLN PGETY+V L  KGTY FYCSPHQGAGMVGQVTVN
Sbjct:   59 ASAVLASNALAVEVLLGASDGGLAFVPSSLEVSAGETIVFKNNAGFPHNVVFDEDEIPAGVDASKISMPEEDLLNAPGETYSVKLDAKGTYKFYCSPHQGAGMVGQVTVN 168          
BLAST of CX287267 vs. ExPASy Swiss-Prot
Match: PLAS2_POPNI (Plastocyanin B, chloroplastic OS=Populus nigra GN=PETE PE=1 SV=2)

HSP 1 Score: 184.111 bits (466), Expect = 4.318e-46
Identity = 88/110 (80.00%), Postives = 99/110 (90.00%), Query Frame = -3
Query:  255 ASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 584
            ASAM+ASNAMA++VLLG DDGSLAFVPS FSV +GEKIVFKNNAGFPHNV+FDED +PSGVDVSKISMS EDLLN  GET+ V L++KG Y+FYCSPHQGAGMVG+V VN
Sbjct:   59 ASAMIASNAMAVDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN 168          
BLAST of CX287267 vs. ExPASy Swiss-Prot
Match: PLAS2_TOBAC (Plastocyanin B'/B'' OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 3.656e-45
Identity = 85/99 (85.86%), Postives = 93/99 (93.94%), Query Frame = -3
Query:  255 IEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 551
            IEVLLG DDG LAFVP +FSVS+GEKI FKNNAGFPHNVVFDEDEIP+GVD SKISMS EDLLNGPGETY+VTL+EKGTY+FYC+PHQGAGMVG+VTVN
Sbjct:    1 IEVLLGSDDGGLAFVPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAGVDASKISMSEEDLLNGPGETYSVTLSEKGTYTFYCAPHQGAGMVGKVTVN 99          
BLAST of CX287267 vs. ExPASy Swiss-Prot
Match: PLAS_SILPR (Plastocyanin, chloroplastic OS=Silene pratensis GN=PETE PE=1 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 6.236e-45
Identity = 85/110 (77.27%), Postives = 95/110 (86.36%), Query Frame = -3
Query:  255 ASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 584
            A+ +LA NAMA EVLLG  DG LAFVPS  S++SGEKI FKNNAGFPHNVVFDEDE+P+GVDV+KISM  EDLLN PGE Y+VTLTEKGTY FYC+PH GAGMVG+VTVN
Sbjct:   56 AAGILAGNAMAAEVLLGSSDGGLAFVPSDLSIASGEKITFKNNAGFPHNVVFDEDEVPAGVDVTKISMPEEDLLNAPGEEYSVTLTEKGTYKFYCAPHAGAGMVGKVTVN 165          
BLAST of CX287267 vs. ExPASy Swiss-Prot
Match: PLAS_RUMOB (Plastocyanin OS=Rumex obtusifolius GN=PETE PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.064e-44
Identity = 83/98 (84.69%), Postives = 93/98 (94.90%), Query Frame = -3
Query:  258 IEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTV 551
            IE+ LGGDDG+LAFVP SF+V++GEKIVFKNNAGFPHN+VFDEDE+P+GVD SKISMS EDLLN PGETYAVTL+EKGTYSFYCSPHQGAGMVG+VTV
Sbjct:    1 IEIKLGGDDGALAFVPGSFTVAAGEKIVFKNNAGFPHNIVFDEDEVPAGVDASKISMSEEDLLNAPGETYAVTLSEKGTYSFYCSPHQGAGMVGKVTV 98          
BLAST of CX287267 vs. ExPASy Swiss-Prot
Match: PLAS1_TOBAC (Plastocyanin A'/A'' OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.389e-44
Identity = 84/99 (84.85%), Postives = 93/99 (93.94%), Query Frame = -3
Query:  255 IEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 551
            IEVLLG DDG LAFVP +FSVS+GEKI FKNNAGFPHNVVFDEDEIP+GVDVSKISMS E+ LNGPGETY+VTL+EKGTY+FYC+PHQGAGMVG+VTVN
Sbjct:    1 IEVLLGSDDGGLAFVPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAGVDVSKISMSEEEYLNGPGETYSVTLSEKGTYTFYCAPHQGAGMVGKVTVN 99          
The following BLAST results are available for this feature:
BLAST of CX287267 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 48
Match NameE-valueIdentityDescription
PLAS_SOLLC1.873e-4985.32Plastocyanin, chloroplastic OS=Solanum lycopersicu... [more]
PLAS_SPIOL1.214e-4883.64Plastocyanin, chloroplastic OS=Spinacia oleracea G... [more]
PLAS1_POPNI2.991e-4782.73Plastocyanin A, chloroplastic OS=Populus nigra GN=... [more]
PLAS2_ARATH8.701e-4780.91Plastocyanin major isoform, chloroplastic OS=Arabi... [more]
PLAS_PEA2.532e-4681.82Plastocyanin, chloroplastic OS=Pisum sativum GN=PE... [more]
PLAS2_POPNI4.318e-4680.00Plastocyanin B, chloroplastic OS=Populus nigra GN=... [more]
PLAS2_TOBAC3.656e-4585.86Plastocyanin B'/B'' OS=Nicotiana tabacum PE=1 SV=1[more]
PLAS_SILPR6.236e-4577.27Plastocyanin, chloroplastic OS=Silene pratensis GN... [more]
PLAS_RUMOB1.064e-4484.69Plastocyanin OS=Rumex obtusifolius GN=PETE PE=1 SV... [more]
PLAS1_TOBAC1.389e-4484.85Plastocyanin A'/A'' OS=Nicotiana tabacum PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01006F06SK Veg1 Citrus clementina cDNA clone C01006F06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287267 ID=CX287267|Name=CX287267|organism=Citrus clementina|type=EST|length=586bp
AGGTGAGTGGGTATAGAGTAACTATTCTCATTACTAAAAGAAAGTCTAAT
GGGGCACCGATGTCTAAATTAGTTACATCACAAATCTGCATTTGAAATAA
ATGGAAAATACAGAGGTTTATTGGCTTGGTTGAAGTGTCTCACCACATAA
CATTCTCTCTCACCAAATGAAAATATGTATGATACTCATAAAATGCAAAA
AGAAGAGAACGATAACCAATGAGATGAGGCAAACAAAGTCTGAATGTGAA
CTTAATTAACAGTCACTTGTCCAACCATGCCAGCTCCTTGGTGAGGGGAA
CAGTAGAAAGAGTAAGTGCCTTTTTCAGTCAGAGTAACAGCATAAGTCTC
TCCAGGACCATTGAGAAGGTCTTCTGTAGACATGGAGATTTTTGAAACAT
CAACACCACTCGGAATCTCATCTTCATCGAAAACAACGTTGTGTGGGAAC
CCAGCATTGTTCTTGAACACAATCTTTTCACCGGAGCTGACAGAGAAAGA
GCTTGGAACAAAAGCCAAGGACCCATCATCACCACCAAGCAAAACCTCAA
TGGCCATGGCATTGCTAGCAAGCATTGCGCTGGCAG
back to top