CX287272

Overview
NameCX287272
Unique NameCX287272
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length462
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX287272 vs. ExPASy Swiss-Prot
Match: SR54C_ARATH (Signal recognition particle 54 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=FFC PE=1 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 9.546e-51
Identity = 98/129 (75.97%), Postives = 113/129 (87.60%), Query Frame = 2
Query:   74 LEPCYPYRMAGRILGMGDVLSFVEKAHEVMPHEDAEELLKKIMSANFDFNDFLKQTRTVARMGSMSRAIGTIPGMGKITPAQVREAETSLKIMEALIEALTPEEREKPHLLAESPVRTKRVAQESGKTE 460
            LEP YP RMAGRILGMGDVLSFVEKA EVM  EDAE+L KKIMSA FDFNDFLKQTR VA+MGSM+R +G IPGMGK++PAQ+REAE +L +MEA+IE +TPEERE+P LLAESP R KR+A++SGKTE
Sbjct:  357 LEPFYPDRMAGRILGMGDVLSFVEKATEVMRQEDAEDLQKKIMSAKFDFNDFLKQTRAVAKMGSMTRVLGMIPGMGKVSPAQIREAEKNLLVMEAMIEVMTPEERERPELLAESPERRKRIAKDSGKTE 485          
BLAST of CX287272 vs. ExPASy Swiss-Prot
Match: SRP54_SYNE7 (Signal sequence-binding protein OS=Synechococcus elongatus (strain PCC 7942) GN=ffh PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 7.112e-30
Identity = 67/130 (51.54%), Postives = 91/130 (70.00%), Query Frame = 2
Query:   74 LEPCYPYRMAGRILGMGDVLSFVEKAHEVMPHEDAEELLKKIMSANFDFNDFLKQTRTVARMGSMSRAIGTIPGM-GKITPAQVREAETSLKIMEALIEALTPEEREKPHLLAESPVRTKRVAQESGKTE 460
            L+P +P RMA RILGMGDVL+ VEKA E +   D E++ +KI++A FDF DFLKQ R +  MGS++  I  IPG+ GKI   Q+R+ E  LK +EA+I ++TP+ER  P LL+ SP R  R+A+  G+TE
Sbjct:  281 LQPFHPERMASRILGMGDVLTLVEKAQEEIDLADVEKMQEKILAAKFDFTDFLKQMRLLKNMGSLAGFIKLIPGLGGKINDEQLRQGERQLKRVEAMINSMTPQERRDPDLLSNSPSRRHRIAKGCGQTE 410          
BLAST of CX287272 vs. ExPASy Swiss-Prot
Match: SRP54_SYNY3 (Signal recognition particle protein OS=Synechocystis sp. (strain PCC 6803) GN=ffh PE=3 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.584e-29
Identity = 64/129 (49.61%), Postives = 87/129 (67.44%), Query Frame = 2
Query:   74 LEPCYPYRMAGRILGMGDVLSFVEKAHEVMPHEDAEELLKKIMSANFDFNDFLKQTRTVARMGSMSRAIGTIPGMGKITPAQVREAETSLKIMEALIEALTPEEREKPHLLAESPVRTKRVAQESGKTE 460
            L+P YP R+A RIL MGDVL+ VEKA E +   D E+L  KI+ A FDF+DF+KQ R +  MGS+   +  IPGM K++   + + E  LK  EA+I ++T EER+ P LLA+SP R +R+AQ SG +E
Sbjct:  281 LQPFYPDRLASRILNMGDVLTLVEKAQEAIDVGDVEKLQNKILEATFDFDDFIKQMRFMKNMGSLGGLLKMIPGMNKLSSGDIEKGEKELKRTEAMISSMTTEERKNPDLLAKSPSRRRRIAQGSGHSE 409          
BLAST of CX287272 vs. ExPASy Swiss-Prot
Match: SRP54_STRMU (Signal recognition particle protein OS=Streptococcus mutans GN=ffh PE=3 SV=3)

HSP 1 Score: 97.8265 bits (242), Expect = 2.293e-20
Identity = 54/129 (41.86%), Postives = 78/129 (60.47%), Query Frame = 2
Query:   74 LEPCYPYRMAGRILGMGDVLSFVEKAHEVMPHEDAEELLKKIMSANFDFNDFLKQTRTVARMGSMSRAIGTIPGMGKITP-AQVREAETSLKIMEALIEALTPEEREKPHLLAESPVRTKRVAQESGKT 457
            +E  +P RM+ RILGMGD+L+ +EKA +    + + EL +K+   +FDFNDF++Q   V  MGSM   +  IPGM      A V+  E  +    A++ ++TPEERE P LL  +P R +R+A  SG T
Sbjct:  283 IETFHPDRMSSRILGMGDLLTLIEKASQDYDEQKSAELAEKMRENSFDFNDFIEQLDQVQNMGSMEDILKMIPGMANNPALANVKVDEGEIARKRAIVSSMTPEERENPDLL--TPSRRRRIASGSGNT 409          
BLAST of CX287272 vs. ExPASy Swiss-Prot
Match: SRP54_RICCN (Signal recognition particle protein OS=Rickettsia conorii GN=ffh PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.941e-19
Identity = 50/124 (40.32%), Postives = 80/124 (64.52%), Query Frame = 2
Query:   95 RMAGRILGMGDVLSFVEKAHEVMPHEDAEELLKKIMSANFDFNDFLKQTRTVARMGSMSRAIGTIPGMGKITPAQVREAETSLKIM---EALIEALTPEEREKPHLLAESPVRTKRVAQESGKT 457
            R+A RIL MGD++SFVEKA  ++  E+AE+   K+    FD ND+L+Q R++ +MG     +  +PG GKI   Q+ +++ + KI+   EA+I ++TP+ER+ P ++  S  R KR+A  +G T
Sbjct:  290 RLASRILDMGDIISFVEKAASIVDREEAEKTAAKLKKGKFDLNDYLQQMRSIKKMGGFGSILSMLPGSGKIMD-QIDQSKLNSKIIEHQEAIILSMTPKERKNPDIINAS--RRKRIAVGAGTT 410          
BLAST of CX287272 vs. ExPASy Swiss-Prot
Match: SRP54_AQUAE (Signal recognition particle protein OS=Aquifex aeolicus GN=ffh PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.941e-19
Identity = 50/128 (39.06%), Postives = 77/128 (60.16%), Query Frame = 2
Query:   74 LEPCYPYRMAGRILGMGDVLSFVEKAHEVMPHEDAEELLKKIMSANFDFNDFLKQTRTVARMGSMSRAIGTIPGMGKITPAQVREAETSLKIMEALIEALTPEEREKPHLLAESPVRTKRVAQESGKT 457
            +EP YP R+A RILG+GD+ S VEKA EV+  + A+ +  K+M+  FD  D  +  R + +MG + + +  IPG+       ++  E   K +EA+I ++TPEER  P ++  S  R KR+A+ SG T
Sbjct:  276 IEPFYPDRIAQRILGLGDIQSLVEKAQEVITEDKAQVMATKVMTGEFDLEDLREMLRMIQQMGPLDKLLSMIPGVAP-QLKHLKVDEKQFKKIEAIINSMTPEERRNPKIINMS--RKKRIARGSGTT 400          
BLAST of CX287272 vs. ExPASy Swiss-Prot
Match: SRP54_RICFE (Signal recognition particle protein OS=Rickettsia felis GN=ffh PE=3 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 7.377e-19
Identity = 50/124 (40.32%), Postives = 79/124 (63.71%), Query Frame = 2
Query:   95 RMAGRILGMGDVLSFVEKAHEVMPHEDAEELLKKIMSANFDFNDFLKQTRTVARMGSMSRAIGTIPGMGKITPAQVREAETSLKIM---EALIEALTPEEREKPHLLAESPVRTKRVAQESGKT 457
            R+A RIL MGD++SFVEKA  ++  E+AE+   K+    FD ND+L+Q R++ +MG     +  +PG GKI   Q+ +++ + KI+   EA+I ++T +ERE P ++  S  R KR+A  +G T
Sbjct:  290 RLASRILDMGDIISFVEKAASIVDREEAEKTAAKLKKGKFDLNDYLQQMRSIKKMGGFGSILSMLPGSGKIMD-QIDQSKLNSKIIEHQEAIILSMTLKERENPDIINAS--RRKRIAAGAGTT 410          
BLAST of CX287272 vs. ExPASy Swiss-Prot
Match: SRP54_HELPJ (Signal recognition particle protein OS=Helicobacter pylori J99 GN=ffh PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 7.377e-19
Identity = 51/129 (39.53%), Postives = 80/129 (62.02%), Query Frame = 2
Query:   74 LEPCYPYRMAGRILGMGDVLSFVEKAHEVMPHEDAEELLKKIMSANFDFNDFLKQTRTVARMGSMSRAIGTIPGMGKITPA-QVREAETSLKI--MEALIEALTPEEREKPHLLAESPVRTKRVAQESG 451
            L+   P R+ GR++G GD++S  EK   V+   +A++L KK+    F FNDFL Q   V ++GSMS  I  IPG+G +  A +  + E+SL++  ++A++ ++T +ERE P +L  S  R KR+A  SG
Sbjct:  274 LDVFMPERIVGRLMGAGDIISLAEKTASVLNPNEAKDLSKKLKKGQFTFNDFLNQIEKVKKLGSMSSLISMIPGLGNMASALKDTDLESSLEVKKIKAMVNSMTKKERENPEILNGS--RRKRIALGSG 400          
BLAST of CX287272 vs. ExPASy Swiss-Prot
Match: SRP54_ECOLI (Signal recognition particle protein OS=Escherichia coli (strain K12) GN=ffh PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.258e-18
Identity = 55/129 (42.64%), Postives = 78/129 (60.47%), Query Frame = 2
Query:   74 LEPCYPYRMAGRILGMGDVLSFVEKAHEVMPHEDAEELLKKIMSAN-FDFNDFLKQTRTVARMGSMSRAIGTIPGMGKITPAQVREA--ETSLKIMEALIEALTPEEREKPHLLAESPVRTKRVAQESG 451
            LEP +P R+A RILGMGDVLS +E     +    AE+L  K+   + FD NDFL+Q R +  MG M+  +G +PGMG+I P  V+    +  L  MEA+I ++T +ER KP ++  S  R +R+A   G
Sbjct:  282 LEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLKKGDGFDLNDFLEQLRQMKNMGGMASLMGKLPGMGQI-PDNVKSQMDDKVLVRMEAIINSMTMKERAKPEIIKGS--RKRRIAAGCG 407          
BLAST of CX287272 vs. ExPASy Swiss-Prot
Match: SRP54_ECOL6 (Signal recognition particle protein OS=Escherichia coli O6 GN=ffh PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.258e-18
Identity = 55/129 (42.64%), Postives = 78/129 (60.47%), Query Frame = 2
Query:   74 LEPCYPYRMAGRILGMGDVLSFVEKAHEVMPHEDAEELLKKIMSAN-FDFNDFLKQTRTVARMGSMSRAIGTIPGMGKITPAQVREA--ETSLKIMEALIEALTPEEREKPHLLAESPVRTKRVAQESG 451
            LEP +P R+A RILGMGDVLS +E     +    AE+L  K+   + FD NDFL+Q R +  MG M+  +G +PGMG+I P  V+    +  L  MEA+I ++T +ER KP ++  S  R +R+A   G
Sbjct:  282 LEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLKKGDGFDLNDFLEQLRQMKNMGGMASLMGKLPGMGQI-PDNVKSQMDDKVLVRMEAIINSMTMKERAKPEIIKGS--RKRRIAAGCG 407          
The following BLAST results are available for this feature:
BLAST of CX287272 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 45
Match NameE-valueIdentityDescription
SR54C_ARATH9.546e-5175.97Signal recognition particle 54 kDa protein, chloro... [more]
SRP54_SYNE77.112e-3051.54Signal sequence-binding protein OS=Synechococcus e... [more]
SRP54_SYNY31.584e-2949.61Signal recognition particle protein OS=Synechocyst... [more]
SRP54_STRMU2.293e-2041.86Signal recognition particle protein OS=Streptococc... [more]
SRP54_RICCN1.941e-1940.32Signal recognition particle protein OS=Rickettsia ... [more]
SRP54_AQUAE1.941e-1939.06Signal recognition particle protein OS=Aquifex aeo... [more]
SRP54_RICFE7.377e-1940.32Signal recognition particle protein OS=Rickettsia ... [more]
SRP54_HELPJ7.377e-1939.53Signal recognition particle protein OS=Helicobacte... [more]
SRP54_ECOLI1.258e-1842.64Signal recognition particle protein OS=Escherichia... [more]
SRP54_ECOL61.258e-1842.64Signal recognition particle protein OS=Escherichia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01006F11SK Veg1 Citrus clementina cDNA clone C01006F11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287272 ID=CX287272|Name=CX287272|organism=Citrus clementina|type=EST|length=462bp
AGACATGCTCATGGCGTATATATTTTTAGATGGTCTACATGATATGTGAA
AATTGAAGCTAACCTGGTTCTTCCTTGAACCTTGCTACCCATATCGCATG
GCTGGACGTATCTTAGGAATGGGAGATGTTCTCTCATTCGTAGAGAAGGC
ACACGAAGTTATGCCGCACGAGGATGCTGAAGAACTGCTGAAGAAGATAA
TGAGTGCGAATTTTGACTTCAATGATTTCTTAAAGCAAACCCGTACTGTT
GCACGTATGGGTTCGATGAGTCGTGCTATAGGAACGATCCCTGGAATGGG
GAAGATTACTCCTGCACAAGTTCGAGAAGCAGAGACGAGTTTAAAAATAA
TGGAAGCACTGATCGAAGCACTGACGCCTGAGGAAAGGGAGAAACCACAT
CTGTTGGCTGAATCTCCTGTCAGAACAAAAAGAGTTGCTCAAGAGTCTGG
GAAAACAGAACA
back to top