CX287273

Overview
NameCX287273
Unique NameCX287273
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length609
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX287273 vs. ExPASy Swiss-Prot
Match: KEULE_ARATH (SNARE-interacting protein KEULE OS=Arabidopsis thaliana GN=KEU PE=1 SV=2)

HSP 1 Score: 199.134 bits (505), Expect = 1.422e-50
Identity = 98/130 (75.38%), Postives = 113/130 (86.92%), Query Frame = -3
Query:  230 YPCMNEPSPTVHAK---NQSAAISQPPVAHSMRSRRTPTWARPRNSDDGYSSDSVLRHASSDFKKMGQRIFVFIVGGATRSELRVCHKLTRKLNREIILGSTSLDDPPQFITKMKMLTV-DELSLDDIQI 607
            +PCMN+PSP+ H     + +A+ SQ   A SMRSRRTPTWA+PR SDDGYSSDSVLRHASSDF+KMGQRIFVFIVGGATRSEL+VCHKL+ KL RE+ILGSTSLDDPPQFITK+K+LT  D+LSLDD+QI
Sbjct:  537 FPCMNDPSPSFHGSTSLSSAASSSQGQAAQSMRSRRTPTWAKPRGSDDGYSSDSVLRHASSDFRKMGQRIFVFIVGGATRSELKVCHKLSTKLKREVILGSTSLDDPPQFITKLKLLTANDDLSLDDLQI 666          
BLAST of CX287273 vs. ExPASy Swiss-Prot
Match: SEC1A_ORYSJ (Probable protein transport Sec1a OS=Oryza sativa subsp. japonica GN=Os04g0252400 PE=3 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 2.973e-40
Identity = 85/131 (64.89%), Postives = 105/131 (80.15%), Query Frame = -3
Query:  230 YPCMNEPSPTVH----AKNQSAAISQPPVAHSMRSRRTP-TWARPRNSDDGYSSDSVLRHASSDFKKMGQRIFVFIVGGATRSELRVCHKLTRKLNREIILGSTSLDDPPQFITKMKMLTVDELSLDDIQI 607
            Y  +N+PSP+      A  Q++   QP  A SMRSRRT  TWARPR+SDDGYSSDSVL+H SS+ +K+GQR+FVF++GGATRSEL   HKL+ KL REIILGS+SLDDPPQFITK+KML+ D+L+LDD+QI
Sbjct:  537 YHYLNDPSPSFRGIPSASTQTSPAHQP--AQSMRSRRTGGTWARPRDSDDGYSSDSVLKHTSSNSRKLGQRLFVFVIGGATRSELCAAHKLSSKLKREIILGSSSLDDPPQFITKLKMLSTDDLTLDDLQI 665          
BLAST of CX287273 vs. ExPASy Swiss-Prot
Match: SEC1B_ORYSJ (Probable protein transport Sec1b OS=Oryza sativa subsp. japonica GN=Os06g0135900 PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 2.782e-38
Identity = 80/118 (67.80%), Postives = 94/118 (79.66%), Query Frame = -3
Query:  263 YPCMNEPSPTVHAKNQSAAISQPPVAHSM--RSRRTPTWARPRNSDDGYSSDS-VLRHASSDFKKMGQRIFVFIVGGATRSELRVCHKLTRKLNREIILGSTSLDDPPQFITKMKMLT 607
            YP M+EPS T     QSAA ++P  A  M  RSRRTPTWA+ RNSDD  SSDS VLRH S+DFK++G RIFVF++GGATRSELR  HKLT KL REI+LGS+S+DDPPQFI+K+KMLT
Sbjct:  535 YPSMSEPSSTEQGSTQSAAATKPAQAQPMSRRSRRTPTWAKSRNSDDSQSSDSSVLRHGSNDFKRLGNRIFVFMIGGATRSELRTVHKLTMKLKREIVLGSSSIDDPPQFISKLKMLT 652          
BLAST of CX287273 vs. ExPASy Swiss-Prot
Match: SEC1A_ARATH (Protein transport Sec1a OS=Arabidopsis thaliana GN=SEC1A PE=2 SV=3)

HSP 1 Score: 157.532 bits (397), Expect = 4.746e-38
Identity = 78/129 (60.47%), Postives = 99/129 (76.74%), Query Frame = -3
Query:  251 YPCMNEPSPTVHAKNQSAAI--SQPPVA--------HSMRSRRTPTWARPRNSDDGYSSDSVLRHASSDFKKMGQRIFVFIVGGATRSELRVCHKLTRKLNREIILGSTSLDDPPQFITKMKMLTVDEL 607
            Y CMN+ S    ++ ++ ++  S  P A        HSMRSRRT TWARP +SDDGYSSDSVL+ AS++FKK+GQRIFVFI+GGATRSELRVCHKLT  L RE++LGSTS DDPPQ+ITK+K+L+  ++
Sbjct:  532 YLCMNQSSHKEESEARTGSVRKSSAPTAVPERKATPHSMRSRRTATWARPHSSDDGYSSDSVLKSASTEFKKLGQRIFVFIIGGATRSELRVCHKLTSSLRREVVLGSTSFDDPPQYITKLKLLSEKDI 660          
BLAST of CX287273 vs. ExPASy Swiss-Prot
Match: SEC1B_ARATH (Protein transport Sec1b OS=Arabidopsis thaliana GN=SEC1B PE=2 SV=2)

HSP 1 Score: 156.377 bits (394), Expect = 1.057e-37
Identity = 85/127 (66.93%), Postives = 97/127 (76.38%), Query Frame = -3
Query:  230 YPCMNEPSPTVHAKNQSAAISQPPVAHSMRSRRTPTWARPRNSDDGYSSDSVLRHASSDFKKMGQRIFVFIVGGATRSELRVCHKLTRKLNREIILGSTSLDDPPQFITKMKMLT-VDELSLDDIQI 607
            YPCMNEP PT ++ + S + S P + HS   RRTPTWAR   SDDGY SDSVL  ASS FK+ GQRIFVFIVGGATRSELRVCHKLT KL+RE+ILGS+S  DP  F+TKMK L   +E+SLDDI I
Sbjct:  540 YPCMNEPKPTFYSGSLSPSAS-PVLPHS---RRTPTWARRHLSDDGYFSDSVLGRASSGFKRKGQRIFVFIVGGATRSELRVCHKLTEKLDREVILGSSSFLDPLTFLTKMKQLNEEEEISLDDIVI 662          
The following BLAST results are available for this feature:
BLAST of CX287273 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
KEULE_ARATH1.422e-5075.38SNARE-interacting protein KEULE OS=Arabidopsis tha... [more]
SEC1A_ORYSJ2.973e-4064.89Probable protein transport Sec1a OS=Oryza sativa s... [more]
SEC1B_ORYSJ2.782e-3867.80Probable protein transport Sec1b OS=Oryza sativa s... [more]
SEC1A_ARATH4.746e-3860.47Protein transport Sec1a OS=Arabidopsis thaliana GN... [more]
SEC1B_ARATH1.057e-3766.93Protein transport Sec1b OS=Arabidopsis thaliana GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01006F12SK Veg1 Citrus clementina cDNA clone C01006F12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287273 ID=CX287273|Name=CX287273|organism=Citrus clementina|type=EST|length=609bp
GGGTTGCAATTATCATATACGTGAGTTTCTTGGTGAATCAGTACATCAAT
TATATAATACACACAAACAGCATAATTCTAGACAGCCGCTACATAATTCT
GGAGACATACATGTGATGTGGCATTAATTGTTGAAAAAAATGGATTGAAT
GAGAATGATATACATGAATGGTTTAGGATCAAGGACTGCAGCTGAAGCTC
AACTCTCCGGACTCCGCCCAGCAGGTTTAGATCTGGATATCATCCAATGA
CAGTTCGTCTACTGTTAGCATCTTCATTTTCGTGATAAATTGAGGCGGAT
CATCCAGACTTGTGGAGCCTAGAATGATTTCTCTGTTCAGCTTTCTTGTG
AGCTTGTGACACACCCTTAACTCTGATCTGGTAGCTCCGCCAACAATAAA
TACAAAAATACGTTGGCCCATCTTCTTGAAATCACTAGATGCATGTCTTA
GTACTGAATCACTTGAATAACCATCATCAGAGTTTCGAGGACGAGCCCAT
GTCGGTGTCCGTCTGGATCTCATTGAATGAGCAACAGGTGGTTGACTAAT
TGCTGCAGACTGGTTTTTCGCATGGACGGTTGGACTCGGCTCATTCATAC
ATGGATAAT
back to top