CX287276

Overview
NameCX287276
Unique NameCX287276
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length611
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX287276 vs. ExPASy Swiss-Prot
Match: RFS1_ARATH (Probable galactinol--sucrose galactosyltransferase 1 OS=Arabidopsis thaliana GN=RFS1 PE=2 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 3.996e-93
Identity = 157/194 (80.93%), Postives = 172/194 (88.66%), Query Frame = 2
Query:   29 PILEGDFRAVLQGNEQNELEICLESGDPDVDEFEGSHLVFVAAGSDPFDVITNAVKTVERHLLTFSHRERKKMPDMLNWFGWCTWDAFYTDVTGEGVKQGLESFEKGGIPPKFIIIDDGWQSVGMDPSGFEFRADNTANFANRLTHIKENHKFQKNGKEGQREEDPALGLRHIVTEIKEKHDLKYVYVWHAITG 610
            PILEGDFRAVLQGNE NELEICLESGDP VD+FEGSHLVFVAAGSDPFDVIT AVK VE+HL TFSHRERKKMPDMLNWFGWCTWDAFYT+VT + VKQGLES + GG+ PKF+IIDDGWQSVGMD +  EF ADN ANFANRLTHIKENHKFQK+GKEG R +DP+L L H++T+IK  + LKYVYVWHAITG
Sbjct:  121 PILEGDFRAVLQGNEANELEICLESGDPTVDQFEGSHLVFVAAGSDPFDVITKAVKAVEQHLQTFSHRERKKMPDMLNWFGWCTWDAFYTNVTAKDVKQGLESLKAGGVTPKFVIIDDGWQSVGMDETSVEFNADNAANFANRLTHIKENHKFQKDGKEGHRVDDPSLSLGHVITDIKSNNSLKYVYVWHAITG 314          
BLAST of CX287276 vs. ExPASy Swiss-Prot
Match: RFS2_ARATH (Probable galactinol--sucrose galactosyltransferase 2 OS=Arabidopsis thaliana GN=RFS2 PE=2 SV=2)

HSP 1 Score: 235.343 bits (599), Expect = 1.811e-61
Identity = 108/194 (55.67%), Postives = 139/194 (71.65%), Query Frame = 2
Query:   29 PILEGDFRAVLQGNEQNELEICLESGDPDVDEFEGSHLVFVAAGSDPFDVITNAVKTVERHLLTFSHRERKKMPDMLNWFGWCTWDAFYTDVTGEGVKQGLESFEKGGIPPKFIIIDDGWQSVGMDPSGFEFRADNTANFANRLTHIKENHKFQKNGKEGQREEDPALGLRHIVTEIKEKHDLKYVYVWHAITG 610
            P+LEG FRAVLQGNE+NE+EIC ESGD  V+  +G+HLV+V AG++PF+VI  +VK VERH+ TF HRE+KK+P  L+WFGWCTWDAFYTDVT EGV +GL+S  +GG PPKF+IIDDGWQ +              A FA RL  IKEN KFQK+     +++    GL+ +V   K++H++K VY WHA+ G
Sbjct:  121 PLLEGQFRAVLQGNEKNEIEICFESGDKAVETSQGTHLVYVHAGTNPFEVIRQSVKAVERHMQTFHHREKKKLPSFLDWFGWCTWDAFYTDVTAEGVDEGLKSLSEGGTPPKFLIIDDGWQQIENKEKDENCVVQEGAQFATRLVGIKENAKFQKS----DQKDTQVSGLKSVVDNAKQRHNVKQVYAWHALAG 310          
BLAST of CX287276 vs. ExPASy Swiss-Prot
Match: RFS6_ARATH (Probable galactinol--sucrose galactosyltransferase 6 OS=Arabidopsis thaliana GN=RFS6 PE=2 SV=2)

HSP 1 Score: 212.231 bits (539), Expect = 1.641e-54
Identity = 102/194 (52.58%), Postives = 137/194 (70.62%), Query Frame = 2
Query:   29 PILEGDFRAVLQGNEQNELEICLESGDPDVDEFEGSHLVFVAAGSDPFDVITNAVKTVERHLLTFSHRERKKMPDMLNWFGWCTWDAFYTDVTGEGVKQGLESFEKGGIPPKFIIIDDGWQSVGMDPSGFEFRADNTANFANRLTHIKENHKFQKNGKEGQREEDPALGLRHIVTEIKEKHDLKYVYVWHAITG 610
            P++EG FR+ LQGN  +E+E+CLESGD D      +H +++ AG+DPF  IT+A++TV+ HL +F  R  KK+P ++++FGWCTWDAFY +VT EGV+ GL+S   GG PPKF+IIDDGWQSV  D +  E   +   +   RLT IKEN KF+K       ++DP +G+++IV   KEKH LKYVYVWHAITG
Sbjct:  127 PLIEGSFRSCLQGNVNDEVELCLESGDVDTKRSSFTHSLYIHAGTDPFQTITDAIRTVKLHLNSFRQRHEKKLPGIVDYFGWCTWDAFYQEVTQEGVEAGLKSLAAGGTPPKFVIIDDGWQSVERDAT-VEAGDEKKESPIFRLTGIKENEKFKK-------KDDPNVGIKNIVKIAKEKHGLKYVYVWHAITG 312          
BLAST of CX287276 vs. ExPASy Swiss-Prot
Match: RFS5_ARATH (Probable galactinol--sucrose galactosyltransferase 5 OS=Arabidopsis thaliana GN=RFS5 PE=1 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.266e-38
Identity = 75/199 (37.69%), Postives = 116/199 (58.29%), Query Frame = 2
Query:   29 PILEGDFRAVLQGNEQNELEICLESGDPDVDEFEGSHLVFVAAGSDPFDVITNAVKTVERHLLTFSHRERKKMPDMLNWFGWCTWDAFYTDVTGEGVKQGLESFEKGGIPPKFIIIDDGWQSVGMDPSGFEFRADNTA----NFANRLTHIKENHKFQKNGKEGQREEDPALGLRHIVTEIKEKHD-LKYVYVWHAITG 610
            P+LEG FR+  Q  E +++ +C+ESG  +V   E   +V+V AG DPF ++ +A+K +  H+ TF   E K  P +++ FGWCTWDAFY  V  +GV +G++    GG PP  ++IDDGWQS+G D  G +    N          RL   +ENHKF+       + +   +G++  V ++K++   + Y+YVWHA+ G
Sbjct:  145 PLLEGSFRSSFQSGEDDDVAVCVESGSTEVTGSEFRQIVYVHAGDDPFKLVKDAMKVIRVHMNTFKLLEEKSPPGIVDKFGWCTWDAFYLTVNPDGVHKGVKCLVDGGCPPGLVLIDDGWQSIGHDSDGIDVEGMNITVAGEQMPCRLLKFEENHKFKDYVSPKDQND---VGMKAFVRDLKDEFSTVDYIYVWHALCG 340          
BLAST of CX287276 vs. ExPASy Swiss-Prot
Match: RFS_PEA (Galactinol--sucrose galactosyltransferase OS=Pisum sativum GN=RFS PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 5.317e-29
Identity = 73/203 (35.96%), Postives = 108/203 (53.20%), Query Frame = 2
Query:   29 PILEGDFRAVLQGNEQNELEICLESGDPDVDEFEGSHLVFVAAGSDPFDVITNAVKTVERHLLTFSHRERKKMPDMLNWFGWCTWDAFYTDVTGEGVKQGLESFEKGGIPPKFIIIDDGWQSVGMDPSGFEFRADNT------ANFANRLTHIKENHKFQ--KNGKEGQREEDPALGLRHIVTEIKEK-HDLKYVYVWHAITG 610
            PILE  FR  LQ    + +++ +ESG   V        +++   +DP+ ++  AVK ++  L TF   E K  P ++  FGWCTWDAFY  V  +GV +G+++   GG PP F+IIDDGWQS+  D        D             RL   +EN+KF+  +NG  G ++     GL   V ++KE+   ++ VYVWHA+ G
Sbjct:  156 PILENSFRTSLQPGLNDYVDMSVESGSTHVTGSTFKACLYLHLSNDPYRLVKEAVKVIQTKLGTFKTLEEKTPPSIIEKFGWCTWDAFYLKVHPKGVWEGVKALTDGGCPPGFVIIDDGWQSISHDDDDPVTERDGMNRTSAGEQMPCRLIKYEENYKFREYENGDNGGKK-----GLVGFVRDLKEEFRSVESVYVWHALCG 353          
BLAST of CX287276 vs. ExPASy Swiss-Prot
Match: RFS_ORYSJ (Galactinol--sucrose galactosyltransferase OS=Oryza sativa subsp. japonica GN=RFS PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 5.317e-29
Identity = 78/202 (38.61%), Postives = 108/202 (53.47%), Query Frame = 2
Query:   29 PILEGDFRAVLQ-GNEQNELEICLESGDPDVDEFEGSHLVFVAAGSDPFDVITNAVKTVERHLLTFSHRERKKMPDMLNWFGWCTWDAFYTDVTGEGVKQGLESFEKGGIPPKFIIIDDGWQSVGMDP----SGFE--FRADNTANFANRLTHIKENHKFQKNGKEGQREEDPALGLRHIVTEIKEKH-DLKYVYVWHAITG 610
            PI+EG FRA L+ G  ++ + + LESG   V        V++ AG DPFD++ +A++ V  HL TF   E K  P +++ FGWCTWDAFY  V  EGV +G+     GG PP  ++IDDGWQS+  D     SG E   R         RL   +EN+KF++             G+   V E+K     ++ VYVWHA+ G
Sbjct:  147 PIVEGPFRACLESGKAEDYVHMVLESGSSTVRGSVFRSAVYLHAGDDPFDLVKDAMRVVRAHLGTFRLMEEKTPPPIVDKFGWCTWDAFYLKVHPEGVWEGVRRLADGGCPPGLVLIDDGWQSICHDDDDLGSGAEGMNRTSAGEQMPCRLIKFQENYKFREYKG----------GMGGFVREMKAAFPTVEQVYVWHALCG 338          
BLAST of CX287276 vs. ExPASy Swiss-Prot
Match: RFS4_ARATH (Probable galactinol--sucrose galactosyltransferase 4 OS=Arabidopsis thaliana GN=RFS4 PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 1.891e-26
Identity = 63/164 (38.41%), Postives = 89/164 (54.27%), Query Frame = 2
Query:   29 PILEGDFRAVLQGNEQNELEICLESGDPDVDEFEGSHLVFVAAGSDPFDVITNAVKTVERHLLTFSHRERKKMPDMLNWFGWCTWDAFYTDVTGEGVKQGLESFEKGGIPPKFIIIDDGWQSVGMDPSGFEFRADNTA----NFANRLTHIKENHKFQKNGKEG 508
            P +EG FRA L   E+  + IC ESG   V E     + ++    +P++++  A   +  H+ TF   E KK+P +++ FGWCTWDA Y  V    +  G++ FE GG+ PKF+IIDDGWQS+  D    +  A+N          RLT  KE  KF +N K G
Sbjct:  156 PTIEGAFRASLTPGEKGNVLICAESGSTKVKESSFKSIAYIHICDNPYNLMKEAFSALRVHMNTFKLLEEKKLPKIVDKFGWCTWDACYLTVDPATIWTGVKEFEDGGVCPKFVIIDDGWQSINFDGDELDKDAENLVLGGEQMTARLTSFKECKKF-RNYKGG 318          
BLAST of CX287276 vs. ExPASy Swiss-Prot
Match: STSYN_PEA (Stachyose synthase OS=Pisum sativum GN=STS1 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.731e-25
Identity = 59/161 (36.65%), Postives = 89/161 (55.28%), Query Frame = 2
Query:   29 PILEGDFRAVLQGNEQNELEICLESGDPDVDEFEGSHLVFVAAGSDPFDVITNAVKTVERHLLTFSHRERKKMPDMLNWFGWCTWDAFYTDVTGEGVKQGLESFEKGGIPPKFIIIDDGWQSVGMDPSGFEFRAD------NTANFANRLTHIKENHKFQK 493
            PI+E  FR+ L     + ++I  ESG   V E   + + +V    +P+D++  A   +  HL +F   E K +P++++ FGWCTWDAFY  V   G+  GL+ F KGG+ P+F+IIDDGWQS+  D  G++   D           + RL    E +KF+K
Sbjct:  142 PIIEKCFRSALFPGFNDHVKIIAESGSTKVKESTFNSIAYVHFSENPYDLMKEAYSAIRVHLNSFRLLEEKTIPNLVDKFGWCTWDAFYLTVNPIGIFHGLDDFSKGGVEPRFVIIDDGWQSISFD--GYDPNEDAKNLVLGGEQMSGRLHRFDECYKFRK 300          
BLAST of CX287276 vs. ExPASy Swiss-Prot
Match: AGAL_SULSO (Alpha-galactosidase OS=Sulfolobus solfataricus GN=galS PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 6.976e-13
Identity = 49/166 (29.52%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  113 DVDEFEGSHLVFVAAGSDPFDVITNAVKTVERHLLTFSHRERKKMPD-MLNWFGWCTWDAFYT-DVTGEGVKQGLESFEKGGIPPKFIIIDDGWQSVGMDPSGFEFRADNTANFANRLTHIKENHKFQKNGKEGQREEDPALGLRHIVTEIKEKHDLKYVYVWHAI 604
            + DE + S+ + +    +P+  I NA+    +   TF  R+ K  PD ++N  GWC+W+AF T D+  E + + ++   + G+   ++IIDDGWQ    D      RA  + N         +N KF               G ++ V  IK    +KYV +WHAI
Sbjct:  172 NTDEIKRSYFLSIGTSDNPYKAIENAINIASKETFTFKLRKEKGFPDKVMNGLGWCSWNAFLTKDLNEENLIKVVKGIIERGLRLNWVIIDDGWQDQNND------RAIRSLN--------PDNKKFPN-------------GFKNTVRAIKSL-GVKYVGLWHAI 309          
The following BLAST results are available for this feature:
BLAST of CX287276 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
RFS1_ARATH3.996e-9380.93Probable galactinol--sucrose galactosyltransferase... [more]
RFS2_ARATH1.811e-6155.67Probable galactinol--sucrose galactosyltransferase... [more]
RFS6_ARATH1.641e-5452.58Probable galactinol--sucrose galactosyltransferase... [more]
RFS5_ARATH6.266e-3837.69Probable galactinol--sucrose galactosyltransferase... [more]
RFS_PEA5.317e-2935.96Galactinol--sucrose galactosyltransferase OS=Pisum... [more]
RFS_ORYSJ5.317e-2938.61Galactinol--sucrose galactosyltransferase OS=Oryza... [more]
RFS4_ARATH1.891e-2638.41Probable galactinol--sucrose galactosyltransferase... [more]
STSYN_PEA2.731e-2536.65Stachyose synthase OS=Pisum sativum GN=STS1 PE=1 S... [more]
AGAL_SULSO6.976e-1329.52Alpha-galactosidase OS=Sulfolobus solfataricus GN=... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01006G05SK Veg1 Citrus clementina cDNA clone C01006G05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287276 ID=CX287276|Name=CX287276|organism=Citrus clementina|type=EST|length=611bp
AGGCCTCGTGCCGAATTCGGCACGAGGGCCAATTCTTGAAGGAGATTTCA
GGGCTGTTCTTCAGGGGAATGAACAAAATGAGCTGGAGATATGTTTGGAG
AGCGGTGATCCTGATGTTGATGAATTTGAAGGGAGTCATTTGGTTTTTGT
GGCAGCTGGATCTGATCCTTTTGATGTAATCACTAATGCAGTAAAAACTG
TTGAGAGACATCTGCTGACTTTTTCCCATCGCGAGAGAAAGAAGATGCCA
GACATGTTGAACTGGTTTGGCTGGTGTACATGGGATGCTTTCTACACTGA
TGTCACAGGAGAGGGTGTGAAGCAAGGATTAGAGAGCTTCGAGAAAGGCG
GAATTCCTCCAAAGTTTATTATAATTGATGATGGCTGGCAATCAGTAGGT
ATGGATCCCAGTGGTTTTGAATTCAGAGCTGATAACACGGCCAACTTTGC
AAACAGGTTGACACATATCAAAGAGAATCACAAGTTTCAGAAAAATGGAA
AAGAGGGTCAAAGAGAAGAGGACCCAGCTTTAGGACTTCGTCACATTGTC
ACAGAGATAAAAGAAAAACATGATCTGAAGTATGTATATGTATGGCATGC
AATAACAGGCT
back to top