CX287277

Overview
NameCX287277
Unique NameCX287277
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length546
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9879 contig Ccv1_Contig9879:16..561. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_LACSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Lactuca sativa GN=RBCS PE=2 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.416e-77
Identity = 130/169 (76.92%), Postives = 149/169 (88.17%), Query Frame = 1
Query:   40 ISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            ISS+ +AT NR +  QAS+ APFTGLKS+ AFP TKK NND +S+ SNGGRVQCMKVWPP GLKK+ETLSYLPPLSDEAL KEI YL+R+ WIPCLEFELE G+VYREHH SPGYYDGRYWTMWKLPM+GCTD+ QV+KEVGE +KEYP++F+R+IGFDN RQVQCISF
Sbjct:    4 ISSSAIATVNRTTSTQASLAAPFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALSKEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAFIRVIGFDNIRQVQCISF 172          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_FAGCR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Fagus crenata GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 2.416e-77
Identity = 136/174 (78.16%), Postives = 154/174 (88.51%), Query Frame = 1
Query:   25 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MASSMISS TVAT +RA+ AQA+MVAPFTGLKS++AFPAT+K+NNDITS+ASNGGRVQCMKVWPP GL+KFETLSYLPPLS E+L K+I YL+  GWIPCLEFELE  +VYRE++ SPGYYDGRYW MWKLPM+GCTDATQVL E+ E  K YP S +RIIGFDNKRQVQCISF
Sbjct:    1 MASSMISSATVATVSRATPAQATMVAPFTGLKSTAAFPATRKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYLPPLSIESLAKQIEYLILKGWIPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAELQEASKTYPTSHIRIIGFDNKRQVQCISF 174          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_PYRPY (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Pyrus pyrifolia GN=RBCS PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 2.045e-76
Identity = 138/176 (78.41%), Postives = 154/176 (87.50%), Query Frame = 1
Query:   25 MASSMISSTTVAT--ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MASSMISS TVAT  A+R + AQA MVAPF GLKSSSAFP T+K+N DITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E+L KE+ YLLR  W+PCLEFELE G+VYRE+H SPGYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP SF+RIIGFDN RQVQCISF
Sbjct:    1 MASSMISSGTVATVSADRPAPAQARMVAPFNGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISF 175          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_MEDSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 2.671e-76
Identity = 129/171 (75.44%), Postives = 150/171 (87.72%), Query Frame = 1
Query:   34 SMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            ++ISS  V T NRAS AQA++VAPFTGLKSS+ FP TKKTNNDITSIASNGGRV CM+VWPP G KKFETLSYLPPL++E L KE+ YL+R GWIPCLEFELEKG+VYRE+H SPGYYDGRYWTMW+LP++G TD++QVLKE+ + + EYP SF+RIIGFDN RQVQCISF
Sbjct:    2 ALISSAAVTTVNRASSAQANLVAPFTGLKSSAGFPVTKKTNNDITSIASNGGRVNCMQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWIPCLEFELEKGFVYRENHRSPGYYDGRYWTMWRLPLFGATDSSQVLKELADCKAEYPDSFIRIIGFDNVRQVQCISF 172          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_BETVE (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Betula verrucosa GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 3.488e-76
Identity = 136/174 (78.16%), Postives = 151/174 (86.78%), Query Frame = 1
Query:   25 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MA SMISS TVA  +RAS AQ+SMVAPFT LKS+SAFP T+KTNNDITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E L KE+ YLLR   IPCLEFELE G+VYREH+ SPGYYDGRYWTMWKLPM+GC D++QVLKE+ E +K YP +F+RIIGFDNKRQVQ ISF
Sbjct:    1 MACSMISSATVAAVSRASPAQSSMVAPFTCLKSTSAFPVTQKTNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSEQLAKEVDYLLRKNLIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCNDSSQVLKELEECKKAYPSAFIRIIGFDNKRQVQIISF 174          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_MALSP (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Malus sp. GN=RBCS PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 5.950e-76
Identity = 138/176 (78.41%), Postives = 154/176 (87.50%), Query Frame = 1
Query:   25 MASSMISSTTVAT--ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MASSMISS TVAT  A+R + AQA MVAPFTGLKSSSA P T+K+N DITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E+L KE+ YLLR  W+PCLEFELE G+VYRE+H SPGYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP SF+RIIGFDN RQVQCISF
Sbjct:    1 MASSMISSGTVATVSADRPAPAQARMVAPFTGLKSSSASPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISF 175          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_HEVBR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Hevea brasiliensis GN=RBCS PE=2 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.122e-74
Identity = 132/174 (75.86%), Postives = 147/174 (84.48%), Query Frame = 1
Query:   25 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MASSM+S+  VA  NRAS AQASMVAPFTGLKS+SAFP T+KT  DITSIASNGGRVQCM+VWPP G K +ETLSYLPPL+ E L KE+ YLLR GW+PCLEFELE G VYRE+H SPGYYDGRYWTMWKLPM+GCTDA QVL+E+ E+ K YP  + RIIGFDN RQVQCISF
Sbjct:    1 MASSMLSTAAVACINRASPAQASMVAPFTGLKSTSAFPTTRKTTTDITSIASNGGRVQCMQVWPPRGKKFYETLSYLPPLTREQLAKEVEYLLRKGWVPCLEFELEHGTVYREYHRSPGYYDGRYWTMWKLPMFGCTDAVQVLQELDEMIKAYPDCYGRIIGFDNVRQVQCISF 174          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS3_SOLTU (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Solanum tuberosum GN=RBCS-3 PE=3 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 2.500e-74
Identity = 130/175 (74.29%), Postives = 154/175 (88.00%), Query Frame = 1
Query:   25 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNN-DITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MASS++SS  VAT  R+++AQASMVAPFTGLKS+++FP TKK NN DITS+ASNGGRV+CM+VWPP  +KK+ETLSYLP LSDE LLKE+ YLL++GW+PCLEFE E G+VYRE+H SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISF
Sbjct:    1 MASSIVSSAAVAT--RSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWIRIIGFDNVRQVQCISF 173          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_MANES (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Manihot esculenta PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 3.265e-74
Identity = 130/174 (74.71%), Postives = 146/174 (83.91%), Query Frame = 1
Query:   25 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MASSM+S+ TVA+ NR S AQA+MVAPFTGLKS+  FP T+KTN+DITSI SNGG+VQCMKVWP  G+KKFETLSYLPPL+ E L  E+ YLLRSGWIPCLEFELE G VYREH   PGYYDGRYWTMWKLPM+GCTDA QVLKE+ E+ K +P  + RIIGFDN RQVQCISF
Sbjct:    1 MASSMLSTATVASINRVSPAQATMVAPFTGLKSTPVFPTTRKTNSDITSITSNGGKVQCMKVWPTLGMKKFETLSYLPPLTREQLASEVEYLLRSGWIPCLEFELEHGLVYREHARVPGYYDGRYWTMWKLPMFGCTDAAQVLKELDELIKHHPDGYARIIGFDNVRQVQCISF 174          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS8_NICPL (Ribulose bisphosphate carboxylase small chain 8B, chloroplastic OS=Nicotiana plumbaginifolia GN=RBCS-8B PE=3 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 7.274e-74
Identity = 130/174 (74.71%), Postives = 151/174 (86.78%), Query Frame = 1
Query:   25 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MASS++SS  VAT  R+++AQA+MVAPFTGLKS+++FP ++K N DITSIASNGGRVQCM+VWPP   KK+ETLSYLP LS E LL EI YLL+SGW+PCLEFE E+G+VYREHH SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP ++VRIIGFDN RQVQCISF
Sbjct:    1 MASSVLSSAAVAT--RSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLSEIEYLLKSGWVPCLEFETERGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWVRIIGFDNVRQVQCISF 172          
The following BLAST results are available for this feature:
BLAST of CX287277 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 127
Match NameE-valueIdentityDescription
RBS_LACSA1.416e-7776.92Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_FAGCR2.416e-7778.16Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_PYRPY2.045e-7678.41Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MEDSA2.671e-7675.44Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_BETVE3.488e-7678.16Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MALSP5.950e-7678.41Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_HEVBR1.122e-7475.86Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS3_SOLTU2.500e-7474.29Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS_MANES3.265e-7474.71Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS8_NICPL7.274e-7474.71Ribulose bisphosphate carboxylase small chain 8B, ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01006G06SK Veg1 Citrus clementina cDNA clone C01006G06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287277 ID=CX287277|Name=CX287277|organism=Citrus clementina|type=EST|length=546bp
AGCTAGAAGAAGGAGCAAGTACCAATGGCTTCCTCAATGATCTCATCGAC
CACCGTTGCCACCGCGAACCGCGCCAGCCTTGCTCAGGCCAGCATGGTCG
CCCCCTTCACCGGCCTCAAGTCTTCTTCTGCTTTCCCAGCAACCAAGAAG
ACCAACAATGACATTACTTCCATTGCAAGCAACGGCGGAAGAGTCCAATG
CATGAAGGTGTGGCCACCAACTGGCTTGAAGAAGTTCGAGACTCTCTCAT
ACCTCCCGCCACTGTCCGATGAAGCTTTGCTCAAGGAAATCAGTTACCTT
CTCCGCTCCGGCTGGATTCCCTGCTTGGAATTCGAGTTGGAGAAAGGATG
GGTGTACCGTGAGCACCACAGCTCACCAGGATACTACGATGGACGCTACT
GGACAATGTGGAAGCTGCCCATGTATGGGTGCACAGATGCAACCCAGGTT
TTGAAGGAGGTTGGGGAGGTCCAGAAGGAATACCCACATTCATTCGTCCG
AATTATCGGATTTGACAACAAGCGTCAAGTGCAGTGCATCAGTTTC
back to top