CX287278

Overview
NameCX287278
Unique NameCX287278
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length598
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX287278_ssr131 microsatellite CX287278_ssr131:131..152. BLAST: Citrus ESTs to Prunus persica proteins V1
CX287278_ssr244 microsatellite CX287278_ssr244:244..255. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig14574 contig Ccv1_Contig14574:29..626. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287278 vs. ExPASy Swiss-Prot
Match: ALIS5_ARATH (ALA-interacting subunit 5 OS=Arabidopsis thaliana GN=ALIS5 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 9.290e-23
Identity = 46/65 (70.77%), Postives = 57/65 (87.69%), Query Frame = 1
Query:  403 YSKFTQQELPACKPILTPKWVILTFLVVGIAFVPIGITSLLASRDVVEIVDRYETDCIPVANRTD 597
            YS+FTQQELPACKPILTP+WVILTFLV G+ F+P+G+  L AS+ VVEIVDRY+TDCIP ++R +
Sbjct:   30 YSRFTQQELPACKPILTPRWVILTFLVAGVVFIPLGVICLFASQGVVEIVDRYDTDCIPTSSRNN 94          
BLAST of CX287278 vs. ExPASy Swiss-Prot
Match: ALIS3_ARATH (ALA-interacting subunit 3 OS=Arabidopsis thaliana GN=ALIS3 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.070e-22
Identity = 47/65 (72.31%), Postives = 56/65 (86.15%), Query Frame = 1
Query:  403 YSKFTQQELPACKPILTPKWVILTFLVVGIAFVPIGITSLLASRDVVEIVDRYETDCIPVANRTD 597
            YSKFTQQELPACKPILTP WVI TFL+V + F+P+G+ SL AS+DVVEIVDRY+T+CIP   RT+
Sbjct:   30 YSKFTQQELPACKPILTPGWVISTFLIVSVIFIPLGVISLFASQDVVEIVDRYDTECIPAPARTN 94          
BLAST of CX287278 vs. ExPASy Swiss-Prot
Match: ALIS1_ARATH (ALA-interacting subunit 1 OS=Arabidopsis thaliana GN=ALIS1 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.752e-21
Identity = 44/65 (67.69%), Postives = 57/65 (87.69%), Query Frame = 1
Query:  403 YSKFTQQELPACKPILTPKWVILTFLVVGIAFVPIGITSLLASRDVVEIVDRYETDCIPVANRTD 597
            YSKFTQQELPACKPILTP WVI TFL++ + F+P+G+ SL AS+DVVEIVDRY++ CIP+++R +
Sbjct:   31 YSKFTQQELPACKPILTPGWVISTFLIISVIFIPLGVISLFASQDVVEIVDRYDSACIPLSDRAN 95          
BLAST of CX287278 vs. ExPASy Swiss-Prot
Match: ALIS4_ARATH (Putative ALA-interacting subunit 4 OS=Arabidopsis thaliana GN=ALIS4 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.063e-18
Identity = 45/79 (56.96%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  406 SKFTQQELPACKPILTPKWVILTFLVVGIAFVPIGITSLLASRD-----------------VVEIVDRYETDCIPVANR 591
            S+FTQQELPACKPILTPKWVILTFLV G+ F+P+G+  L AS+                  V+EIVDRY+TDCIP+++R
Sbjct:   17 SRFTQQELPACKPILTPKWVILTFLVSGVVFIPLGVICLFASQGVCFKSFLTFLSYNYIYFVIEIVDRYDTDCIPLSSR 95          
BLAST of CX287278 vs. ExPASy Swiss-Prot
Match: ALIS2_ARATH (Putative ALA-interacting subunit 2 OS=Arabidopsis thaliana GN=ALIS2 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.450e-15
Identity = 35/63 (55.56%), Postives = 49/63 (77.78%), Query Frame = 1
Query:  409 KFTQQELPACKPILTPKWVILTFLVVGIAFVPIGITSLLASRDVVEIVDRYETDCIPVANRTD 597
            +F QQ+LPACKP+LTP  VI  F+++G  F+PIG+ +L ASRD +EI+DRY+ +CIP   RT+
Sbjct:   28 QFKQQKLPACKPVLTPISVITVFMLMGFVFIPIGLITLRASRDAIEIIDRYDVECIPEEYRTN 90          
The following BLAST results are available for this feature:
BLAST of CX287278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
ALIS5_ARATH9.290e-2370.77ALA-interacting subunit 5 OS=Arabidopsis thaliana ... [more]
ALIS3_ARATH2.070e-2272.31ALA-interacting subunit 3 OS=Arabidopsis thaliana ... [more]
ALIS1_ARATH1.752e-2167.69ALA-interacting subunit 1 OS=Arabidopsis thaliana ... [more]
ALIS4_ARATH1.063e-1856.96Putative ALA-interacting subunit 4 OS=Arabidopsis ... [more]
ALIS2_ARATH2.450e-1555.56Putative ALA-interacting subunit 2 OS=Arabidopsis ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01006G07SK Veg1 Citrus clementina cDNA clone C01006G07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287278 ID=CX287278|Name=CX287278|organism=Citrus clementina|type=EST|length=598bp
GTGTAGAGCTAGCTCAGGCTCAGGCTTGGAGTGGAGATGCAGAAACTTCT
GCTTTCTATCGTCTTCGTTTTCAAAGTCAAAACAAGAGCAAACCAAATCA
AACCGGAGCATCATATTTAAATTGAAATTTTATATATATATATATATATA
TAAAACTCATAAGCCAACTTTCTTGTATTTGTTGCCCCATCTCACTCCCA
CAACTCTTTCTTTGATTTTCCCCCAAAAAAATAAAAATAAAAAAAAGAAA
GAAAGAAACGGAAACTTTGTTTTTGTAGTCAGTGTAATCTAATTCCGATC
TCTATGATGAATTCCAATGCGGCGTCGTCCAGCACGGCCAATCCCGACGC
TGCTGGATCCCCTGATCCTCCGGCTCCCAGGCGAAGCTCTAAGCGACCCA
AGTATTCCAAGTTTACTCAACAGGAGCTTCCGGCTTGCAAGCCGATTCTT
ACGCCGAAATGGGTGATTCTAACATTTTTGGTCGTTGGCATTGCGTTCGT
CCCGATTGGAATTACTTCCCTCCTTGCTTCCCGAGATGTTGTTGAAATTG
TTGATCGGTACGAGACTGATTGCATACCAGTAGCTAATAGGACTGACA
back to top