CX287279

Overview
NameCX287279
Unique NameCX287279
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length623
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14542 contig Ccv1_Contig14542:734..1356. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287279 vs. ExPASy Swiss-Prot
Match: A115_TOBAC (Auxin-induced protein PCNT115 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 9.054e-16
Identity = 38/45 (84.44%), Postives = 41/45 (91.11%), Query Frame = 3
Query:   24 RIGTRAVKKGCTRSQLALAWVHHQGDDVCPIPGTTKIENLNQNIK 158
            RI   AV+KGCT SQLALAWVHHQG+DVCPIPGTTKIENLNQN+K
Sbjct:  258 RICEMAVRKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQNMK 302          
The following BLAST results are available for this feature:
BLAST of CX287279 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
A115_TOBAC9.054e-1684.44Auxin-induced protein PCNT115 OS=Nicotiana tabacum... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01006G08SK Veg1 Citrus clementina cDNA clone C01006G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287279 ID=CX287279|Name=CX287279|organism=Citrus clementina|type=EST|length=623bp
GAATTCGGCACGAGGCCTCGTGCCGAATCGGCACGAGGGCTGTAAAGAAA
GGATGCACCCGATCTCAGCTTGCATTAGCATGGGTTCATCACCAAGGAGA
TGATGTGTGTCCAATTCCTGGAACCACCAAGATTGAAAACCTGAATCAAA
ATATTAAAGCTCTGTCAGTGAAACTAACTCCGGAAGAAATTGCTGAGCTT
GAATCCATTGCTTCAGCAGATGCTGTACGGGGTCATCGATATGGGGGTGT
CACTCCTACCTATGAAGATTCTGAAACTCCTCCACTGTCTTCATGGAAAC
CTTCATAAAGGGCATTGGTAGTCTGCCTTCTTAGTACCGATTTTGCAATT
GCATTTAGTTCCAAGGTTTTGTTGTGGGTAAAATTACTGTATTGTGAGTA
AAGATAAAGTCATCGTGTCTTCTGATAGGACACCCTATTAGTACCTTTCT
GCACTTTTCACAAGTGTTTAGTGAATATTGTATTGAGTTCGTATGTAGTG
TTGTGAGCAAAACTAAATCAATGTATCTTCTGCTCTTCTGCTTTGAGCAG
CAAAATAATGTACTGTGTTTATACAAATATATGAGAAACAATAAATAAAT
CAAAAAAAAAAAAAAAAAAAACT
back to top