CX287285

Overview
NameCX287285
Unique NameCX287285
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length552
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX287285 vs. ExPASy Swiss-Prot
Match: UGPA_PYRPY (UTP--glucose-1-phosphate uridylyltransferase OS=Pyrus pyrifolia PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 2.611e-87
Identity = 161/177 (90.96%), Postives = 171/177 (96.61%), Query Frame = 2
Query:   20 VEVTPKTLADVKGGTLISYEGKVKLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVDGIKVLQLETAAGAAIRFFDHAIGCNVHRSRFLPVKATSDLLLVQSDLYTLADGFVTRNEARKNPANPTIELGPEFKKVGNFLSRFKSIPSIIELDS 550
            +EVTPKTLADVKGGTLISYEG+V+LLEIAQVPD+HVNEFKSIEKFKIFNTNNLWVNL AIKRLVEADALKMEIIPNPKEVDG+KVLQLETAAGAAIRFF+HAIG NV RSRFLPVKATSDLLLVQSDLYTL DGFVTRN ARKNP NPTIELGPEFKKVG++LSRFKSIPSI+EL+S
Sbjct:  247 MEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDQHVNEFKSIEKFKIFNTNNLWVNLNAIKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFNHAIGINVPRSRFLPVKATSDLLLVQSDLYTLQDGFVTRNSARKNPENPTIELGPEFKKVGSYLSRFKSIPSILELES 423          
BLAST of CX287285 vs. ExPASy Swiss-Prot
Match: UGPA1_ARATH (UTP--glucose-1-phosphate uridylyltransferase 1 OS=Arabidopsis thaliana GN=At5g17310 PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 2.611e-87
Identity = 162/177 (91.53%), Postives = 170/177 (96.05%), Query Frame = 2
Query:   20 VEVTPKTLADVKGGTLISYEGKVKLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVDGIKVLQLETAAGAAIRFFDHAIGCNVHRSRFLPVKATSDLLLVQSDLYTLADGFVTRNEARKNPANPTIELGPEFKKVGNFLSRFKSIPSIIELDS 550
            +EVTPKTLADVKGGTLISYEGKV+LLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIK+LVEADALKMEIIPNPKEVDG+KVLQLETAAGAAIRFFD+AIG NV RSRFLPVKATSDLLLVQSDLYTL DGFVTRN+AR NP NP IELGPEFKKV +FLSRFKSIPSI+ELDS
Sbjct:  246 MEVTPKTLADVKGGTLISYEGKVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKKLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDNAIGVNVPRSRFLPVKATSDLLLVQSDLYTLVDGFVTRNKARTNPTNPAIELGPEFKKVASFLSRFKSIPSIVELDS 422          
BLAST of CX287285 vs. ExPASy Swiss-Prot
Match: UGPA2_ARATH (Probable UTP--glucose-1-phosphate uridylyltransferase 2 OS=Arabidopsis thaliana GN=At3g03250 PE=1 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 5.816e-87
Identity = 161/177 (90.96%), Postives = 171/177 (96.61%), Query Frame = 2
Query:   20 VEVTPKTLADVKGGTLISYEGKVKLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVDGIKVLQLETAAGAAIRFFDHAIGCNVHRSRFLPVKATSDLLLVQSDLYTLADGFVTRNEARKNPANPTIELGPEFKKVGNFLSRFKSIPSIIELDS 550
            +EVTPKTLADVKGGTLISYEGKV+LLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIK+LVEADALKMEIIPNPKEVDG+KVLQLETAAGAAIRFFD+AIG NV RSRFLPVKA+SDLLLVQSDLYTL DGFVTRN+AR NP+NP+IELGPEFKKV  FLSRFKSIPSI+ELDS
Sbjct:  245 MEVTPKTLADVKGGTLISYEGKVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKKLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDNAIGVNVPRSRFLPVKASSDLLLVQSDLYTLVDGFVTRNKARTNPSNPSIELGPEFKKVATFLSRFKSIPSIVELDS 421          
BLAST of CX287285 vs. ExPASy Swiss-Prot
Match: UGPA_MUSAC (UTP--glucose-1-phosphate uridylyltransferase OS=Musa acuminata GN=UGPA PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 7.596e-87
Identity = 161/177 (90.96%), Postives = 169/177 (95.48%), Query Frame = 2
Query:   20 VEVTPKTLADVKGGTLISYEGKVKLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVDGIKVLQLETAAGAAIRFFDHAIGCNVHRSRFLPVKATSDLLLVQSDLYTLADGFVTRNEARKNPANPTIELGPEFKKVGNFLSRFKSIPSIIELDS 550
            +EVTPKTLADVKGGTLISYEG+V+LLEIAQVPD HVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVDG+KVLQLETAAGAAIRFFDHAIG NV RSRFLPVKATSDLLLVQSDLY L DGFV RN+AR NP+NP+IELGPEFKKV NFLSRFKSIPSI+ELDS
Sbjct:  243 MEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDAHVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDHAIGINVPRSRFLPVKATSDLLLVQSDLYMLVDGFVIRNKARTNPSNPSIELGPEFKKVANFLSRFKSIPSIVELDS 419          
BLAST of CX287285 vs. ExPASy Swiss-Prot
Match: UGPA_SOLTU (UTP--glucose-1-phosphate uridylyltransferase OS=Solanum tuberosum PE=1 SV=3)

HSP 1 Score: 310.842 bits (795), Expect = 2.702e-84
Identity = 159/178 (89.33%), Postives = 167/178 (93.82%), Query Frame = 2
Query:   20 VEVTPKTLADVKGGTLISYEGKVKLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVDGIKVLQLETAAGAAIRFFDHAIGCNVHRSRFLPVKATSDLLLVQSDLYTLAD-GFVTRNEARKNPANPTIELGPEFKKVGNFLSRFKSIPSIIELDS 550
            +EVTPKTLADVKGGTLISYEGKV+LLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNL AIKRLVEADALKMEIIPNPKEVDG+KVLQLETAAGAAI+FFD AIG NV RSRFLPVKATSDLLLVQSDLYTL D G+V RN AR NP+NP+IELGPEFKKV NFL RFKSIPSII+LDS
Sbjct:  252 MEVTPKTLADVKGGTLISYEGKVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLSAIKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIKFFDRAIGANVPRSRFLPVKATSDLLLVQSDLYTLTDEGYVIRNPARSNPSNPSIELGPEFKKVANFLGRFKSIPSIIDLDS 429          
BLAST of CX287285 vs. ExPASy Swiss-Prot
Match: UGPA_ASTPN (UTP--glucose-1-phosphate uridylyltransferase OS=Astragalus penduliflorus GN=UGP PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 7.861e-84
Identity = 157/177 (88.70%), Postives = 166/177 (93.79%), Query Frame = 2
Query:   20 VEVTPKTLADVKGGTLISYEGKVKLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVDGIKVLQLETAAGAAIRFFDHAIGCNVHRSRFLPVKATSDLLLVQSDLYTLADGFVTRNEARKNPANPTIELGPEFKKVGNFLSRFKSIPSIIELDS 550
            +EVTPKTLADVKGGTLISYEG+V+LLEIAQVPDEHV EFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVDG+KVLQLETAAGAAIRFFD AIG NV RSRFLPVKATSDLLLVQSDLYT+ +G V RN+AR NP NP+IELGPEFKKV NFL RFKSIPSI+ELDS
Sbjct:  247 MEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVGEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDKAIGINVPRSRFLPVKATSDLLLVQSDLYTVENGSVIRNKARTNPENPSIELGPEFKKVSNFLGRFKSIPSIVELDS 423          
BLAST of CX287285 vs. ExPASy Swiss-Prot
Match: UGPA_HORVU (UTP--glucose-1-phosphate uridylyltransferase OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.341e-83
Identity = 155/177 (87.57%), Postives = 168/177 (94.92%), Query Frame = 2
Query:   20 VEVTPKTLADVKGGTLISYEGKVKLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVDGIKVLQLETAAGAAIRFFDHAIGCNVHRSRFLPVKATSDLLLVQSDLYTLADGFVTRNEARKNPANPTIELGPEFKKVGNFLSRFKSIPSIIELDS 550
            +EVTPKTLADVKGGTLISYEG+V+LLEIAQVPDEHV+EFKSIEKFKIFNTNNLWVNLKAIKRLV+A+ALKMEIIPNPKEVDG+KVLQLETAAGAAIRFF+ AIG NV RSRFLPVKATSDLLLVQSDLYTL DG+V RN AR  P+NP+IELGPEFKKV NFL+RFKSIPSI+ELDS
Sbjct:  249 MEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVDEFKSIEKFKIFNTNNLWVNLKAIKRLVDAEALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFEKAIGINVPRSRFLPVKATSDLLLVQSDLYTLVDGYVIRNPARVKPSNPSIELGPEFKKVANFLARFKSIPSIVELDS 425          
BLAST of CX287285 vs. ExPASy Swiss-Prot
Match: UGPA_CRIGR (UTP--glucose-1-phosphate uridylyltransferase OS=Cricetulus griseus GN=UGP2 PE=2 SV=3)

HSP 1 Score: 218.009 bits (554), Expect = 2.383e-56
Identity = 110/177 (62.15%), Postives = 141/177 (79.66%), Query Frame = 2
Query:   20 VEVTPKTLADVKGGTLISYEGKVKLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVD-GIKVLQLETAAGAAIRFFDHAIGCNVHRSRFLPVKATSDLLLVQSDLYTLADGFVTRNEARKNPANPTIELGPEFKKVGNFLSRFKSIPSIIELD 547
            +EVT KT ADVKGGTL  YEGK++L+EIAQVP  HV+EFKS+ KFKIFNTNNLW++L A+KRL E +A+ MEII NPK +D G+ V+QLETA GAAI+ F++++G NV RSRFLPVK TSDLLLV S+LY+L  G +T +E R+ P  P ++LG  F KV ++L RF+SIP ++ELD
Sbjct:  280 MEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELD 456          
BLAST of CX287285 vs. ExPASy Swiss-Prot
Match: UGPA_BOVIN (UTP--glucose-1-phosphate uridylyltransferase OS=Bos taurus GN=UGP2 PE=1 SV=2)

HSP 1 Score: 218.009 bits (554), Expect = 2.383e-56
Identity = 110/177 (62.15%), Postives = 141/177 (79.66%), Query Frame = 2
Query:   20 VEVTPKTLADVKGGTLISYEGKVKLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVD-GIKVLQLETAAGAAIRFFDHAIGCNVHRSRFLPVKATSDLLLVQSDLYTLADGFVTRNEARKNPANPTIELGPEFKKVGNFLSRFKSIPSIIELD 547
            +EVT KT ADVKGGTL  YEGK++L+EIAQVP  HV+EFKS+ KFKIFNTNNLW++L A+KRL E +A+ MEII NPK +D G+ V+QLETA GAAI+ F++++G NV RSRFLPVK TSDLLLV S+LY+L  G +T +E R+ P  P ++LG  F KV ++L RF+SIP ++ELD
Sbjct:  280 MEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELD 456          
BLAST of CX287285 vs. ExPASy Swiss-Prot
Match: UGPA_MOUSE (UTP--glucose-1-phosphate uridylyltransferase OS=Mus musculus GN=Ugp2 PE=2 SV=3)

HSP 1 Score: 217.624 bits (553), Expect = 3.113e-56
Identity = 110/177 (62.15%), Postives = 141/177 (79.66%), Query Frame = 2
Query:   20 VEVTPKTLADVKGGTLISYEGKVKLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKRLVEADALKMEIIPNPKEVD-GIKVLQLETAAGAAIRFFDHAIGCNVHRSRFLPVKATSDLLLVQSDLYTLADGFVTRNEARKNPANPTIELGPEFKKVGNFLSRFKSIPSIIELD 547
            +EVT KT ADVKGGTL  YEGK++L+EIAQVP  HV+EFKS+ KFKIFNTNNLW++L A+KRL E +A+ MEII NPK +D G+ V+QLETA GAAI+ F++++G NV RSRFLPVK TSDLLLV S+LY+L  G +T +E R+ P  P ++LG  F KV ++L RF+SIP ++ELD
Sbjct:  280 MEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLGAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELD 456          
The following BLAST results are available for this feature:
BLAST of CX287285 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
UGPA_PYRPY2.611e-8790.96UTP--glucose-1-phosphate uridylyltransferase OS=Py... [more]
UGPA1_ARATH2.611e-8791.53UTP--glucose-1-phosphate uridylyltransferase 1 OS=... [more]
UGPA2_ARATH5.816e-8790.96Probable UTP--glucose-1-phosphate uridylyltransfer... [more]
UGPA_MUSAC7.596e-8790.96UTP--glucose-1-phosphate uridylyltransferase OS=Mu... [more]
UGPA_SOLTU2.702e-8489.33UTP--glucose-1-phosphate uridylyltransferase OS=So... [more]
UGPA_ASTPN7.861e-8488.70UTP--glucose-1-phosphate uridylyltransferase OS=As... [more]
UGPA_HORVU1.341e-8387.57UTP--glucose-1-phosphate uridylyltransferase OS=Ho... [more]
UGPA_CRIGR2.383e-5662.15UTP--glucose-1-phosphate uridylyltransferase OS=Cr... [more]
UGPA_BOVIN2.383e-5662.15UTP--glucose-1-phosphate uridylyltransferase OS=Bo... [more]
UGPA_MOUSE3.113e-5662.15UTP--glucose-1-phosphate uridylyltransferase OS=Mu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01006H02SK Veg1 Citrus clementina cDNA clone C01006H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287285 ID=CX287285|Name=CX287285|organism=Citrus clementina|type=EST|length=552bp
GCCTCGTGCCGGGCACGAGGTGGAGGTTACTCCCAAAACCTTAGCAGATG
TTAAGGGTGGAACTCTTATTTCTTATGAAGGAAAAGTTAAGCTTCTGGAA
ATCGCTCAGGTCCCTGATGAACATGTCAATGAGTTCAAGTCAATAGAGAA
GTTCAAAATTTTCAACACGAATAACTTATGGGTGAACTTGAAGGCAATCA
AAAGGTTAGTGGAAGCTGATGCACTTAAGATGGAGATCATTCCAAATCCA
AAGGAAGTGGATGGAATCAAAGTTCTTCAGCTAGAAACTGCAGCTGGTGC
TGCAATTCGGTTCTTTGATCATGCTATTGGTTGTAACGTACATCGATCTC
GATTCCTTCCGGTGAAGGCAACTTCTGATCTGCTTCTTGTCCAGTCTGAT
CTTTACACCTTGGCCGATGGATTTGTTACTCGGAATGAAGCTAGAAAAAA
CCCTGCAAATCCAACTATTGAACTGGGACCTGAATTTAAGAAGGTTGGCA
ACTTTTTGAGCCGATTCAAGTCTATTCCTAGTATCATCGAGCTTGATAGC
CT
back to top