CX287318

Overview
NameCX287318
Unique NameCX287318
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length440
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14313 contig Ccv1_Contig14313:241..680. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287318 vs. ExPASy Swiss-Prot
Match: MDHC_MAIZE (Malate dehydrogenase, cytoplasmic OS=Zea mays PE=2 SV=2)

HSP 1 Score: 266.929 bits (681), Expect = 2.492e-71
Identity = 131/139 (94.24%), Postives = 136/139 (97.84%), Query Frame = 2
Query:   23 ELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPD 439
            ELVDAAFPL+KGVVATTD VEACTGVN+AVMVGGFPRKEGMERKDVMSKNVSIYK+QASALE HAAPNCKVLVVANPANTNALILKEFAPSIP KN+TCLTRLDHNRALGQISE+LNVQVSDVKNVIIWGNHSSSQYPD
Sbjct:   57 ELVDAAFPLLKGVVATTDVVEACTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEAHAAPNCKVLVVANPANTNALILKEFAPSIPEKNVTCLTRLDHNRALGQISERLNVQVSDVKNVIIWGNHSSSQYPD 195          
BLAST of CX287318 vs. ExPASy Swiss-Prot
Match: MDHC_MESCR (Malate dehydrogenase, cytoplasmic OS=Mesembryanthemum crystallinum GN=MDH PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 5.552e-71
Identity = 131/139 (94.24%), Postives = 136/139 (97.84%), Query Frame = 2
Query:   23 ELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPD 439
            ELVDAAFPL+KGVVATTDA EAC GVN+AVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIP KNI+CLTRLDHNRALGQISE+LNVQVSDVKNVIIWGNHSS+QYPD
Sbjct:   57 ELVDAAFPLLKGVVATTDAAEACKGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLDHNRALGQISERLNVQVSDVKNVIIWGNHSSTQYPD 195          
BLAST of CX287318 vs. ExPASy Swiss-Prot
Match: MDHC_ORYSJ (Malate dehydrogenase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os10g0478200 PE=1 SV=3)

HSP 1 Score: 264.233 bits (674), Expect = 1.615e-70
Identity = 129/139 (92.81%), Postives = 135/139 (97.12%), Query Frame = 2
Query:   23 ELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPD 439
            ELVDAAFPL+KG+VATTD VEACTGVN+AVMVGGFPRKEGMERKDVMSKNVSIYK+QASALE HAAPNCKVLVVANPANTNALILKEFAPSIP KNITCLTRLDHNRALGQISEKLNVQV+DVKN IIWGNHSS+QYPD
Sbjct:   57 ELVDAAFPLLKGIVATTDVVEACTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEAHAAPNCKVLVVANPANTNALILKEFAPSIPEKNITCLTRLDHNRALGQISEKLNVQVTDVKNAIIWGNHSSTQYPD 195          
BLAST of CX287318 vs. ExPASy Swiss-Prot
Match: MDHC2_ARATH (Malate dehydrogenase, cytoplasmic 2 OS=Arabidopsis thaliana GN=At5g43330 PE=2 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 2.110e-70
Identity = 129/139 (92.81%), Postives = 137/139 (98.56%), Query Frame = 2
Query:   23 ELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPD 439
            ELVDAAFPL+KGVVATTDAVEACTGVN+AVMVGGFPRKEGMERKDVMSKNVSIYK+QASALE+HAAPNCKVLVVANPANTNALILKEFAPSIP KNITCLTRLDHNRALGQ+SE+L+V VSDVKNVIIWGNHSS+QYPD
Sbjct:   57 ELVDAAFPLLKGVVATTDAVEACTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEKHAAPNCKVLVVANPANTNALILKEFAPSIPEKNITCLTRLDHNRALGQVSERLSVPVSDVKNVIIWGNHSSTQYPD 195          
BLAST of CX287318 vs. ExPASy Swiss-Prot
Match: MDHC_MEDSA (Malate dehydrogenase, cytoplasmic OS=Medicago sativa GN=CMDH PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 1.047e-69
Identity = 129/139 (92.81%), Postives = 136/139 (97.84%), Query Frame = 2
Query:   23 ELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPD 439
            ELVDAAFPL+KGVVATTD VEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYK+QASALE+HAA NCKVLVVANPANTNALILKEFAPSIP +NI+CLTRLDHNRALGQISE+LNVQVSDVKNVIIWGNHSS+QYPD
Sbjct:   57 ELVDAAFPLLKGVVATTDVVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEKHAAANCKVLVVANPANTNALILKEFAPSIPERNISCLTRLDHNRALGQISERLNVQVSDVKNVIIWGNHSSTQYPD 195          
BLAST of CX287318 vs. ExPASy Swiss-Prot
Match: MDHC1_ARATH (Malate dehydrogenase, cytoplasmic 1 OS=Arabidopsis thaliana GN=At1g04410 PE=1 SV=2)

HSP 1 Score: 260.766 bits (665), Expect = 1.786e-69
Identity = 127/139 (91.37%), Postives = 136/139 (97.84%), Query Frame = 2
Query:   23 ELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPD 439
            EL+DAAFPL+KGVVATTDAVE CTGVN+AVMVGGFPRKEGMERKDVMSKNVSIYK+QA+ALE+HAAPNCKVLVVANPANTNALILKEFAPSIP KNI+CLTRLDHNRALGQISE+L+V VSDVKNVIIWGNHSSSQYPD
Sbjct:   57 ELIDAAFPLLKGVVATTDAVEGCTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKHAAPNCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLDHNRALGQISERLSVPVSDVKNVIIWGNHSSSQYPD 195          
BLAST of CX287318 vs. ExPASy Swiss-Prot
Match: MDHC_BETVU (Malate dehydrogenase, cytoplasmic OS=Beta vulgaris GN=NR1 PE=1 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 3.046e-69
Identity = 128/139 (92.09%), Postives = 133/139 (95.68%), Query Frame = 2
Query:   23 ELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPD 439
            ELVDAAFPL+KGVVATTD  EAC GVN+AVMVGGFPRKEGMERKDVM KNVSIYK+QASALEQ+AAPNCKVLVVANPANTNALILKEFAPSIP KNITCLTRLDHNRALGQISE+LN QVSDVKNVIIWGNHSSSQYPD
Sbjct:   57 ELVDAAFPLLKGVVATTDVAEACKGVNVAVMVGGFPRKEGMERKDVMPKNVSIYKSQASALEQYAAPNCKVLVVANPANTNALILKEFAPSIPEKNITCLTRLDHNRALGQISERLNAQVSDVKNVIIWGNHSSSQYPD 195          
BLAST of CX287318 vs. ExPASy Swiss-Prot
Match: MDHC_XENTR (Malate dehydrogenase, cytoplasmic OS=Xenopus tropicalis GN=mdh1 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.575e-41
Identity = 81/139 (58.27%), Postives = 104/139 (74.82%), Query Frame = 2
Query:   23 ELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPD 439
            EL D A PL+K V+AT     A   +++A++VG  PR+EGMERKD++  NV I+K+Q +AL +++  + KV+VV NPANTN L   + APSIP +N +CLTRLDHNRA GQI+ KLNV   DVKNVIIWGNHSS+QYPD
Sbjct:   56 ELQDCALPLLKEVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALNKYSKKSVKVIVVGNPANTNCLTAMKSAPSIPKENFSCLTRLDHNRAKGQIALKLNVASDDVKNVIIWGNHSSTQYPD 194          
BLAST of CX287318 vs. ExPASy Swiss-Prot
Match: MDHC_RAT (Malate dehydrogenase, cytoplasmic OS=Rattus norvegicus GN=Mdh1 PE=1 SV=3)

HSP 1 Score: 167.162 bits (422), Expect = 2.687e-41
Identity = 81/139 (58.27%), Postives = 103/139 (74.10%), Query Frame = 2
Query:   23 ELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPD 439
            EL D A PL++ V+AT     A   +++AV+VG  PR+EGMERKD++  NV I+K+Q +ALE++A  + KV+VV NPANTN L   + APSIP +N +CLTRLDHNRA  QI+ KL V   DVKNVIIWGNHSS+QYPD
Sbjct:   56 ELQDCALPLLQDVIATDKEEVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPD 194          
BLAST of CX287318 vs. ExPASy Swiss-Prot
Match: MDHC_HUMAN (Malate dehydrogenase, cytoplasmic OS=Homo sapiens GN=MDH1 PE=1 SV=4)

HSP 1 Score: 167.162 bits (422), Expect = 2.687e-41
Identity = 80/139 (57.55%), Postives = 104/139 (74.82%), Query Frame = 2
Query:   23 ELVDAAFPLIKGVVATTDAVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRALGQISEKLNVQVSDVKNVIIWGNHSSSQYPD 439
            EL D A PL+K V+AT     A   +++A++VG  PR+EGMERKD++  NV I+K+Q +AL+++A  + KV+VV NPANTN L   + APSIP +N +CLTRLDHNRA  QI+ KL V  +DVKNVIIWGNHSS+QYPD
Sbjct:   56 ELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPD 194          
The following BLAST results are available for this feature:
BLAST of CX287318 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 186
Match NameE-valueIdentityDescription
MDHC_MAIZE2.492e-7194.24Malate dehydrogenase, cytoplasmic OS=Zea mays PE=2... [more]
MDHC_MESCR5.552e-7194.24Malate dehydrogenase, cytoplasmic OS=Mesembryanthe... [more]
MDHC_ORYSJ1.615e-7092.81Malate dehydrogenase, cytoplasmic OS=Oryza sativa ... [more]
MDHC2_ARATH2.110e-7092.81Malate dehydrogenase, cytoplasmic 2 OS=Arabidopsis... [more]
MDHC_MEDSA1.047e-6992.81Malate dehydrogenase, cytoplasmic OS=Medicago sati... [more]
MDHC1_ARATH1.786e-6991.37Malate dehydrogenase, cytoplasmic 1 OS=Arabidopsis... [more]
MDHC_BETVU3.046e-6992.09Malate dehydrogenase, cytoplasmic OS=Beta vulgaris... [more]
MDHC_XENTR1.575e-4158.27Malate dehydrogenase, cytoplasmic OS=Xenopus tropi... [more]
MDHC_RAT2.687e-4158.27Malate dehydrogenase, cytoplasmic OS=Rattus norveg... [more]
MDHC_HUMAN2.687e-4157.55Malate dehydrogenase, cytoplasmic OS=Homo sapiens ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01008C02SK Veg1 Citrus clementina cDNA clone C01008C02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287318 ID=CX287318|Name=CX287318|organism=Citrus clementina|type=EST|length=440bp
CTCGTGCCGAATTCGGCACGAGGAGTTGGTTGATGCTGCATTCCCTCTTA
TTAAAGGTGTTGTTGCTACAACTGATGCTGTTGAGGCATGCACTGGGGTC
AATATTGCCGTTATGGTTGGTGGCTTTCCAAGAAAAGAAGGAATGGAGAG
AAAAGATGTGATGTCAAAGAACGTTTCAATCTACAAGGCTCAGGCTTCTG
CCCTGGAGCAGCACGCAGCTCCGAACTGCAAGGTTCTAGTTGTCGCTAAC
CCTGCAAACACCAATGCATTGATTCTGAAAGAATTTGCGCCATCAATCCC
TGCTAAGAACATTACATGCTTGACCAGATTGGATCATAACAGGGCATTGG
GACAAATATCTGAGAAACTGAATGTCCAAGTATCTGATGTTAAGAATGTG
ATTATTTGGGGAAATCATTCATCATCTCAGTACCCTGATG
back to top