CX287325

Overview
NameCX287325
Unique NameCX287325
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length414
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX287325 vs. ExPASy Swiss-Prot
Match: Y4UB_RHISN (Uncharacterized aminotransferase y4uB OS=Rhizobium sp. (strain NGR234) GN=NGR_a01380 PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.095e-25
Identity = 54/135 (40.00%), Postives = 84/135 (62.22%), Query Frame = 2
Query:    2 FGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVK-AFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPP 403
            FGR G+MFG   Y I+PDL++ AK L+SAY P+ A +V  +V +V+   ++ +G+FSHG+TYSGHP+  A A   L I ++ ++     ++   FQ  +K  F+  PI+GE+RG GL+   EF  ++   + F P
Sbjct:  267 FGRTGSMFGSQHYGIEPDLITVAKGLTSAYFPLSASIVGEKVYKVLEDGADRVGAFSHGYTYSGHPIGAAAANAVLDIVEKEDLPGNAREVGGYFQAQLKEKFAQLPIVGEVRGVGLMGAIEFVGDRENKKRFDP 401          
BLAST of CX287325 vs. ExPASy Swiss-Prot
Match: BIOK_BACSU (Lysine-8-amino-7-oxononanoate aminotransferase OS=Bacillus subtilis GN=bioK PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 7.992e-21
Identity = 44/135 (32.59%), Postives = 77/135 (57.04%), Query Frame = 2
Query:    2 FGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPE 406
            FGR G MF C+  +++PDL++  K ++  Y+PI     + ++ +  +     L +F HG +Y+G+ + CAVA+E L +++  NIVEQV + + K    ++     P +G+IR  G + G E   +K   EP+P +
Sbjct:  257 FGRTGKMFACEHENVQPDLMAAGKGITGGYLPIAVTFATEDIYKAFYDDYENLKTFFHGHSYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHALPHVGDIRQLGFMCGAELVRSKETKEPYPAD 391          
BLAST of CX287325 vs. ExPASy Swiss-Prot
Match: BIOA_BACSH (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Bacillus sphaericus GN=bioA PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.044e-20
Identity = 43/136 (31.62%), Postives = 77/136 (56.62%), Query Frame = 2
Query:    2 FGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQD-GVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPE 406
            FGR GT+F C++ +I PD +  +K L+  Y+P+  ++ + +V +  +    T+ +F H  +Y+G+ ++C VA+E L I++E   ++ V     + +   ++AFSD P +GE R  G +   E   N+   EP P E
Sbjct:  262 FGRTGTLFACEQANISPDFMCLSKGLTGGYLPLSVVMTTNDVYQAFYDDYATMKAFLHSHSYTGNTLACRVALEVLAIFEEEQYIDVVQDKGERMRKLALEAFSDLPFVGEYRQVGFVGAIELVANRDTKEPLPSE 397          
BLAST of CX287325 vs. ExPASy Swiss-Prot
Match: YHXA_BACSU (Uncharacterized aminotransferase yhxA OS=Bacillus subtilis GN=yhxA PE=3 SV=4)

HSP 1 Score: 94.3597 bits (233), Expect = 1.969e-19
Identity = 42/131 (32.06%), Postives = 76/131 (58.02%), Query Frame = 2
Query:    2 FGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEP 394
            FGR G  FG   Y +KPD+++ AK ++SAY+P+ A  V  ++ E    ++     F H  T+ G P +CA+A++ L+I ++  ++++   +  K    ++A  + P +G++RG GL++G E   +K   EP
Sbjct:  260 FGRTGEPFGFMHYGVKPDIITMAKGITSAYLPLSATAVKRDIFEAYQGEA-PYDRFRHVNTFGGSPAACALALKNLQIMEDEQLIQRSRDLGAKLLGELQALREHPAVGDVRGKGLLIGIELVKDKLTKEP 389          
BLAST of CX287325 vs. ExPASy Swiss-Prot
Match: OAPT_PSEPU (Omega-amino acid--pyruvate aminotransferase OS=Pseudomonas putida PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.480e-19
Identity = 42/118 (35.59%), Postives = 71/118 (60.17%), Query Frame = 2
Query:    2 FGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNT--LGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGL 349
            FGR G+MFG D + + PDL+  AK +++  +P+GA++ S E+ +   +Q        F HG+TYS HPV+CA  + AL + ++ N+V+ V ++AP F+  +     +  + +IR  GL
Sbjct:  265 FGRTGSMFGADSFGVTPDLMCIAKQVTNGAIPMGAVIASTEIYQTFMNQPTPEYAVEFPHGYTYSAHPVACAAGLAALCLLQKENLVQSVAEVAPHFEKALHGIKGAKNVIDIRNFGL 382          
BLAST of CX287325 vs. ExPASy Swiss-Prot
Match: BIOA_AQUAE (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Aquifex aeolicus GN=bioA PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.666e-18
Identity = 40/133 (30.08%), Postives = 73/133 (54.89%), Query Frame = 2
Query:    2 FGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFP 400
            FGR GTMF C++  + PD +   K ++  Y+P+ A L + EV      +      F HG TY+G+ ++C+VA+  L++++E   +E++       ++ ++ F +   +G++R  G + G E   +K   EPFP
Sbjct:  263 FGRTGTMFYCEQEGVSPDFMCLGKGITGGYLPLAATLTTDEVFNAFLGEFGEAKHFYHGHTYTGNNLACSVALANLEVFEEERTLEKLQPKIKLLKERLQEFWELKHVGDVRQLGFMAGIELVKDKEKGEPFP 395          
BLAST of CX287325 vs. ExPASy Swiss-Prot
Match: BIOA_METJA (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Methanocaldococcus jannaschii GN=bioA PE=3 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 8.271e-18
Identity = 40/137 (29.20%), Postives = 71/137 (51.82%), Query Frame = 2
Query:    2 FGRLGTMFGCDKYSIK----PDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFP 400
            FGR G MF CD   +K    PD++   K L+  Y+P+ A L + E+      +        HG TY+G+ + C+ A+  L+I+++ N++E +      F   ++   +   +G++RG G ++G E   +K   EP+P
Sbjct:  269 FGRTGKMFFCDNEELKKLEKPDILCLGKGLTGGYLPLAATLTTDEIYNQFLGEFGESKQLYHGHTYTGNQLLCSAALATLEIFEKENVIENIQPKIKLFHKELRKLKELEHVGDVRGRGFMVGIELVKDKETKEPYP 405          
BLAST of CX287325 vs. ExPASy Swiss-Prot
Match: YGD3_SCHPO (Uncharacterized aminotransferase C1771.03c OS=Schizosaccharomyces pombe GN=SPBC1773.03c PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.143e-17
Identity = 44/136 (32.35%), Postives = 68/136 (50.00%), Query Frame = 2
Query:    5 GRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGV-KAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPEW 409
            GR GTM   ++  + PD+ S AK L   Y PI   LV   +  V   +   +  F   FTY  HP++C+ A+    I +  ++VE+  ++     + + + F   P +G IRG GL  G E   +K+  E FPPE+
Sbjct:  263 GRTGTMHAWEQEGVTPDIQSIAKCLGGGYQPISGALVGHRIMNVFEQKDAAMAGF---FTYQAHPIACSAALAVQTILRRDHLVERAAEMGKYLSEKLHETFDSHPNVGNIRGRGLFWGLEIVKDKATKECFPPEY 395          
BLAST of CX287325 vs. ExPASy Swiss-Prot
Match: YODT_BACSU (Uncharacterized aminotransferase yodT OS=Bacillus subtilis GN=yodT PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 4.105e-17
Identity = 49/135 (36.30%), Postives = 70/135 (51.85%), Query Frame = 2
Query:    5 GRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGV-KAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPE 406
            GR G M   + +   PD+    K L + Y PI A +VS  + E I   S  + S   G TYS HP S   A+E L+   +  +++Q  K     +  + +A S S IIGE+RG GL+LG EF  ++   + FPPE
Sbjct:  246 GRTGRMLATEHWDTVPDIAVLGKGLGAGYAPIAAAVVSDSIIETIKQGSGVIMS---GHTYSAHPYSAKAALEVLRYVLKHGLIKQSEKKGAVLKKKLDEAASQSGIIGEVRGKGLLLGIEFVADQKTKKVFPPE 377          
BLAST of CX287325 vs. ExPASy Swiss-Prot
Match: GABT_ECOLI (4-aminobutyrate aminotransferase OS=Escherichia coli (strain K12) GN=gabT PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.560e-16
Identity = 39/131 (29.77%), Postives = 77/131 (58.78%), Query Frame = 2
Query:    5 GRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDS-PIIGEIRGTGLILGTEFADNKSPNEP 394
            GR GT+F  ++  + PDL +FAK+++  + P+  +    EV + +            G TY+G+P++C  A+E LK++++ N++++ N +  K +DG+ A ++  P IG++RG G ++  E  ++   N+P
Sbjct:  246 GRTGTLFAMEQMGVAPDLTTFAKSIAGGF-PLAGVTGRAEVMDAV-------APGGLGGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFEDGDHNKP 368          
The following BLAST results are available for this feature:
BLAST of CX287325 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
Y4UB_RHISN4.095e-2540.00Uncharacterized aminotransferase y4uB OS=Rhizobium... [more]
BIOK_BACSU7.992e-2132.59Lysine-8-amino-7-oxononanoate aminotransferase OS=... [more]
BIOA_BACSH1.044e-2031.62Adenosylmethionine-8-amino-7-oxononanoate aminotra... [more]
YHXA_BACSU1.969e-1932.06Uncharacterized aminotransferase yhxA OS=Bacillus ... [more]
OAPT_PSEPU7.480e-1935.59Omega-amino acid--pyruvate aminotransferase OS=Pse... [more]
BIOA_AQUAE1.666e-1830.08Adenosylmethionine-8-amino-7-oxononanoate aminotra... [more]
BIOA_METJA8.271e-1829.20Adenosylmethionine-8-amino-7-oxononanoate aminotra... [more]
YGD3_SCHPO3.143e-1732.35Uncharacterized aminotransferase C1771.03c OS=Schi... [more]
YODT_BACSU4.105e-1736.30Uncharacterized aminotransferase yodT OS=Bacillus ... [more]
GABT_ECOLI1.560e-1629.774-aminobutyrate aminotransferase OS=Escherichia co... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01008C10SK Veg1 Citrus clementina cDNA clone C01008C10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287325 ID=CX287325|Name=CX287325|organism=Citrus clementina|type=EST|length=414bp
ATTTGGAAGACTTGGCACAATGTTTGGTTGTGACAAATACAGCATTAAAC
CAGATCTTGTGTCCTTCGCAAAGGCCCTTTCTTCAGCATATATGCCCATT
GGAGCTATTCTTGTGAGTCCCGAAGTTTCAGAAGTCATTCACTCTCAAAG
CAACACACTTGGTTCTTTCTCTCATGGATTTACTTATTCTGGGCATCCTG
TTTCCTGTGCCGTTGCCATCGAAGCGCTTAAGATTTACAAGGAAAGAAAT
ATTGTTGAGCAAGTAAATAAGATAGCGCCAAAGTTTCAAGATGGTGTAAA
AGCCTTTTCTGATAGTCCCATCATTGGAGAGATTCGGGGCACTGGTTTGA
TTCTTGGTACAGAGTTTGCAGACAACAAGTCTCCAAATGAACCGTTCCCT
CCTGAATGGGGGAT
back to top