CX287326

Overview
NameCX287326
Unique NameCX287326
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length395
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12075 contig Ccv1_Contig12075:45..439. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287326 vs. ExPASy Swiss-Prot
Match: DNJ16_ARATH (Chaperone protein dnaJ 16 OS=Arabidopsis thaliana GN=ATJ16 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 7.653e-24
Identity = 52/62 (83.87%), Postives = 55/62 (88.71%), Query Frame = 2
Query:  209 MPAQRSKSERTDAGKQLRRDPYEVLGVSRNCTDQEIKSAYRKMALKYHPDKNANDPVAADIF 394
            MP  RSKSE+ DA KQLRRDPYEVLGV RN TDQEIKSAYRK+ALKYHPDK ANDPVAAD+F
Sbjct:    1 MPGHRSKSEKKDADKQLRRDPYEVLGVLRNSTDQEIKSAYRKLALKYHPDKTANDPVAADMF 62          
BLAST of CX287326 vs. ExPASy Swiss-Prot
Match: DNJ39_ARATH (Chaperone protein dnaJ 39 OS=Arabidopsis thaliana GN=ATJ39 PE=2 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 9.061e-17
Identity = 41/65 (63.08%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  209 MPAQRSKSERTDAGKQ---LRRDPYEVLGVSRNCTDQEIKSAYRKMALKYHPDKNANDPVAADIF 394
            M    S+SE  DAG++    RR+PYEVLG+  N TDQEIKSAYR+MAL+YHPDKN +DPVAA++F
Sbjct:    1 MATHSSRSENKDAGEEDELRRRNPYEVLGIPSNSTDQEIKSAYRRMALRYHPDKNPDDPVAAEMF 65          
BLAST of CX287326 vs. ExPASy Swiss-Prot
Match: DNJ15_ARATH (Chaperone protein dnaJ 15 OS=Arabidopsis thaliana GN=ATJ15 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.179e-14
Identity = 34/45 (75.56%), Postives = 41/45 (91.11%), Query Frame = 2
Query:  260 RRDPYEVLGVSRNCTDQEIKSAYRKMALKYHPDKNANDPVAADIF 394
            RRDPYEVL VS++  DQEIKSAYRK+ALKYHPDKNAN+P A+++F
Sbjct:   15 RRDPYEVLCVSKDANDQEIKSAYRKLALKYHPDKNANNPDASELF 59          
BLAST of CX287326 vs. ExPASy Swiss-Prot
Match: DNAJ_PELCD (Chaperone protein dnaJ OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 5.688e-11
Identity = 30/45 (66.67%), Postives = 35/45 (77.78%), Query Frame = 2
Query:  260 RRDPYEVLGVSRNCTDQEIKSAYRKMALKYHPDKNANDPVAADIF 394
            +RD YEVLGV RN ++ EIK AYRK+A+KYHPDKNA D  A D F
Sbjct:    3 KRDYYEVLGVHRNASETEIKKAYRKLAIKYHPDKNAGDKAAEDKF 47          
BLAST of CX287326 vs. ExPASy Swiss-Prot
Match: DNAJ_METFK (Chaperone protein dnaJ OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.703e-11
Identity = 28/45 (62.22%), Postives = 38/45 (84.44%), Query Frame = 2
Query:  260 RRDPYEVLGVSRNCTDQEIKSAYRKMALKYHPDKNANDPVAADIF 394
            +RD YEVLGV+R+ TD+EIK AYRK+A+KYHPD+N ++P A + F
Sbjct:    3 KRDYYEVLGVNRDATDEEIKKAYRKLAMKYHPDRNPDNPKAEEHF 47          
BLAST of CX287326 vs. ExPASy Swiss-Prot
Match: DNAJ_CARHZ (Chaperone protein dnaJ OS=Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.703e-11
Identity = 29/46 (63.04%), Postives = 37/46 (80.43%), Query Frame = 2
Query:  257 LRRDPYEVLGVSRNCTDQEIKSAYRKMALKYHPDKNANDPVAADIF 394
            ++RD YE+LGV+RN T +EIK AYRK+A KYHPD N +DP AA+ F
Sbjct:    1 MKRDYYEILGVARNATPEEIKKAYRKLARKYHPDVNKDDPNAAEKF 46          
The following BLAST results are available for this feature:
BLAST of CX287326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
DNJ16_ARATH7.653e-2483.87Chaperone protein dnaJ 16 OS=Arabidopsis thaliana ... [more]
DNJ39_ARATH9.061e-1763.08Chaperone protein dnaJ 39 OS=Arabidopsis thaliana ... [more]
DNJ15_ARATH7.179e-1475.56Chaperone protein dnaJ 15 OS=Arabidopsis thaliana ... [more]
DNAJ_PELCD5.688e-1166.67Chaperone protein dnaJ OS=Pelobacter carbinolicus ... [more]
DNAJ_METFK9.703e-1162.22Chaperone protein dnaJ OS=Methylobacillus flagella... [more]
DNAJ_CARHZ9.703e-1163.04Chaperone protein dnaJ OS=Carboxydothermus hydroge... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01008C11SK Veg1 Citrus clementina cDNA clone C01008C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287326 ID=CX287326|Name=CX287326|organism=Citrus clementina|type=EST|length=395bp
TGGATGTTCCATCAAGTCTAGTCTAGGGTTTCCTTATTCTTTTCTCACCA
GTCTGTTATTTTTCCGAGAAAAGATTAAGAAAAAAAAATGCGAGAGAATT
TGGGAGGAGCAATTGTTTGTTTTTCGTTTTCGTCTAAAAAAAATTTTCTG
TCTCGGTAGTGGTTTCTAGGGCCTTTGAGTGGAGTTTTTTCACGTTCTTT
TATTGAAAATGCCGGCTCAACGATCCAAGTCCGAGAGAACCGATGCGGGA
AAGCAGCTCCGGCGGGACCCCTACGAGGTTCTCGGCGTCTCCAGGAACTG
TACGGATCAAGAAATCAAGAGCGCCTACAGGAAAATGGCTCTCAAGTACC
ATCCTGATAAGAATGCAAATGACCCTGTAGCAGCTGATATTTTTA
back to top