CX287328

Overview
NameCX287328
Unique NameCX287328
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length407
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14816 contig Ccv1_Contig14816:636..1042. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287328 vs. ExPASy Swiss-Prot
Match: DXR_ORYSJ (1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic OS=Oryza sativa subsp. japonica GN=DXR PE=2 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 3.734e-26
Identity = 57/68 (83.82%), Postives = 60/68 (88.24%), Query Frame = -3
Query:  202 AANEKAVEMFIDEKIGYLDIFKVVELTCDKHRADLVTSPSLEDIIHYDAWAREYAAGLQFSFGKSPVP 405
            AANEKAVE+FIDEKIGYLDIFKVVELTCD HR +LVT PSLE+IIHYD WAREYAA LQ S G SPVP
Sbjct:  405 AANEKAVELFIDEKIGYLDIFKVVELTCDAHRNELVTRPSLEEIIHYDLWAREYAASLQPSTGLSPVP 472          
BLAST of CX287328 vs. ExPASy Swiss-Prot
Match: DXR_ARATH (1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic OS=Arabidopsis thaliana GN=DXR PE=2 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 4.876e-26
Identity = 56/69 (81.16%), Postives = 60/69 (86.96%), Query Frame = -3
Query:  199 AANEKAVEMFIDEKIGYLDIFKVVELTCDKHRADLVTSPSLEDIIHYDAWAREYAAGLQFSFGKSPVPA 405
            AANEKAVEMFIDEKI YLDIFKVVELTCDKHR +LVTSPSLE+I+HYD WAREYAA +Q S G  PV A
Sbjct:  409 AANEKAVEMFIDEKISYLDIFKVVELTCDKHRNELVTSPSLEEIVHYDLWAREYAANVQLSSGARPVHA 477          
BLAST of CX287328 vs. ExPASy Swiss-Prot
Match: DXR_MENPI (1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic OS=Mentha piperita GN=DXR PE=2 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 7.785e-24
Identity = 51/66 (77.27%), Postives = 58/66 (87.88%), Query Frame = -3
Query:  208 AANEKAVEMFIDEKIGYLDIFKVVELTCDKHRADLVTSPSLEDIIHYDAWAREYAAGLQFSFGKSP 405
            AANEKAVEMFIDEKIGYLDIFKVVELTCDKHR+++  SPSLE+I+HYD WAR+YAA +  S G SP
Sbjct:  402 AANEKAVEMFIDEKIGYLDIFKVVELTCDKHRSEMAVSPSLEEIVHYDQWARDYAATVLKSAGLSP 467          
BLAST of CX287328 vs. ExPASy Swiss-Prot
Match: DXR_PROMT (1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Prochlorococcus marinus (strain NATL2A) GN=dxr PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.989e-11
Identity = 29/53 (54.72%), Postives = 41/53 (77.36%), Query Frame = -3
Query:  247 AANEKAVEMFIDEKIGYLDIFKVVELTCDKHRADLVTSPSLEDIIHYDAWARE 405
            AANEKAVE+F++E+  ++DI KV+E  C+KH+ DL  +PSL +I+  D WARE
Sbjct:  345 AANEKAVELFLEERFKFIDIPKVIEAICEKHKCDLNLNPSLSEILEIDNWARE 397          
BLAST of CX287328 vs. ExPASy Swiss-Prot
Match: DXR_PROM1 (1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Prochlorococcus marinus (strain NATL1A) GN=dxr PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.989e-11
Identity = 29/53 (54.72%), Postives = 41/53 (77.36%), Query Frame = -3
Query:  247 AANEKAVEMFIDEKIGYLDIFKVVELTCDKHRADLVTSPSLEDIIHYDAWARE 405
            AANEKAVE+F++E+  ++DI KV+E  C+KH+ DL  +PSL +I+  D WARE
Sbjct:  345 AANEKAVELFLEERFKFIDIPKVIEAICEKHKCDLNLNPSLSEILEIDNWARE 397          
BLAST of CX287328 vs. ExPASy Swiss-Prot
Match: DXR_SYNPX (1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Synechococcus sp. (strain WH8102) GN=dxr PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.598e-11
Identity = 35/73 (47.95%), Postives = 47/73 (64.38%), Query Frame = -3
Query:  187 AANEKAVEMFIDEKIGYLDIFKVVELTCDKHRADLVTSPSLEDIIHYDAWAREYAAGLQFSFGKSPVPA*LLA 405
            AANE+AV  F++EKI +LDI  V+E  C++H+ADL+  P LED++  D WAR  A   Q   G + VP   LA
Sbjct:  337 AANEEAVAQFLEEKIHFLDIPVVIEAACERHKADLIAHPQLEDVLAVDQWAR-MAVREQVKRGTTRVPLAALA 408          
BLAST of CX287328 vs. ExPASy Swiss-Prot
Match: DXR_PROMM (1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Prochlorococcus marinus (strain MIT 9313) GN=dxr PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.871e-11
Identity = 27/53 (50.94%), Postives = 41/53 (77.36%), Query Frame = -3
Query:  247 AANEKAVEMFIDEKIGYLDIFKVVELTCDKHRADLVTSPSLEDIIHYDAWARE 405
            AANE+AV  F++E+I +LDI +V+E  C++H+ DL T P L+D++  DAWAR+
Sbjct:  340 AANEEAVAQFLEERIHFLDIPEVIEAACERHKPDLQTQPQLDDVLAVDAWARK 392          
The following BLAST results are available for this feature:
BLAST of CX287328 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
DXR_ORYSJ3.734e-2683.821-deoxy-D-xylulose 5-phosphate reductoisomerase, c... [more]
DXR_ARATH4.876e-2681.161-deoxy-D-xylulose 5-phosphate reductoisomerase, c... [more]
DXR_MENPI7.785e-2477.271-deoxy-D-xylulose 5-phosphate reductoisomerase, c... [more]
DXR_PROMT1.989e-1154.721-deoxy-D-xylulose 5-phosphate reductoisomerase OS... [more]
DXR_PROM11.989e-1154.721-deoxy-D-xylulose 5-phosphate reductoisomerase OS... [more]
DXR_SYNPX2.598e-1147.951-deoxy-D-xylulose 5-phosphate reductoisomerase OS... [more]
DXR_PROMM9.871e-1150.941-deoxy-D-xylulose 5-phosphate reductoisomerase OS... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01008D01SK Veg1 Citrus clementina cDNA clone C01008D01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287328 ID=CX287328|Name=CX287328|organism=Citrus clementina|type=EST|length=407bp
TTTTTTTTTTTTTTTTTAAAAAATGCATTCATACATTTGCACCTATAAAA
TCGGGGACACATACTGAATCCCCACCTTATATTTATTTATGGTACAATTG
CTCGATGCCTCTTTAAACATTGACGAGAATACCAGTTTTTGGCAAAAAGT
AAACACATCTCTTTAGTTCTCAAAGTAGGGCATCAATGCAAGCAGTCATG
CTGGAACAGGGCTTTTACCAAATGAAAATTGCAAACCAGCTGCATACTCT
CGCGCCCATGCATCATAATGGATTATATCCTCTAGGGAAGGCGAGGTTAC
CAAGTCCGCCCTGTGCTTATCACACGTTAGCTCCACAACCTTGAAAATAT
CCAGATAGCCAATCTTTTCATCAATGAACATCTCTACTGCTTTCTCGTTA
GCTGCAC
back to top