CX287332

Overview
NameCX287332
Unique NameCX287332
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length406
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig7097 contig Ccv1_Contig7097:141..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: TRXM4_ARATH (Thioredoxin M-type 4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=1 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 1.237e-37
Identity = 76/137 (55.47%), Postives = 95/137 (69.34%), Query Frame = 1
Query:   16 SISGRR----KFAEFKGLKVRPXXXXXXXXXXXXXXXXLRRGAQIVCEAQET---AVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405
            S+S RR    +F EF+GLK                   + RG +I CEAQ+T   AVEVP ++D+ WQ+ VL+S  PVLVEFWAPWCGPCRMIHPI+D+L+K + GK K YK+NTDESP+ A RYGIRS+PTV+IFK
Sbjct:   30 SVSRRRISPARFLEFRGLKSSRSLVTQSASLGANRRTRIARGGRIACEAQDTTAAAVEVPNLSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNTANRYGIRSVPTVIIFK 166          
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: TRXM_BRANA (Thioredoxin M-type, chloroplastic OS=Brassica napus PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 7.025e-33
Identity = 59/95 (62.11%), Postives = 80/95 (84.21%), Query Frame = 1
Query:  118 LRRGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIF 402
            LRRG  I+CEAQ+TA  +P V D+TW+SLVL +  PV+V+FWAPWCGPC+MI PI++EL++QY GK+K +K+NTD+SP+   +YG+RSIPT+MIF
Sbjct:   57 LRRGG-IICEAQDTATGIPMVNDSTWESLVLKADEPVVVDFWAPWCGPCKMIDPIVNELAQQYTGKIKFFKLNTDDSPATPGKYGVRSIPTIMIF 150          
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: TRXM_PEA (Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.669e-32
Identity = 59/90 (65.56%), Postives = 74/90 (82.22%), Query Frame = 1
Query:  136 IVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405
            ++  A+E   EV  V D++W  LV+ S +PVLV+FWAPWCGPCRMI PIIDEL+K+Y GK+KCYK+NTDESP+ AT+YGIRSIPTV+ FK
Sbjct:   58 VLLHAREAVNEVQVVNDSSWDELVIGSETPVLVDFWAPWCGPCRMIAPIIDELAKEYAGKIKCYKLNTDESPNTATKYGIRSIPTVLFFK 147          
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: TRXM_ORYSJ (Thioredoxin M-type, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.486e-32
Identity = 60/96 (62.50%), Postives = 74/96 (77.08%), Query Frame = 1
Query:  118 LRRGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405
            LR  ++  C+      EV    +  W S+VL S +PVLVEFWAPWCGPCRMI P+IDEL+K+YVGK+KC KVNTD+SP+IAT YGIRSIPTV++FK
Sbjct:   50 LRPASRFACQCSNVVDEVVVADEKNWDSMVLGSEAPVLVEFWAPWCGPCRMIAPVIDELAKEYVGKIKCCKVNTDDSPNIATNYGIRSIPTVLMFK 145          
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: TRXM2_ARATH (Thioredoxin M-type 2, chloroplastic OS=Arabidopsis thaliana GN=At4g03520 PE=1 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 5.947e-32
Identity = 65/133 (48.87%), Postives = 89/133 (66.92%), Query Frame = 1
Query:   13 NSISGRRKFA---EFKGLKVRPXXXXXXXXXXXXXXXXLRRGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIF 402
            +S+S RR FA   E  GL++R                   R A +VCEAQET  ++  V D+TW SLVL +  PV+V+FWAPWCGPC+MI P++++L++ Y GK+K YK+NTDESP+   +YG+RSIPT+MIF
Sbjct:   28 SSLSSRRMFAVLPESSGLRIRLSLSPASLTSIHQPRVSRLRRA-VVCEAQETTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIF 159          
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: TRXM1_ARATH (Thioredoxin M-type 1, chloroplastic OS=Arabidopsis thaliana GN=At1g03680 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 5.947e-32
Identity = 58/95 (61.05%), Postives = 77/95 (81.05%), Query Frame = 1
Query:  118 LRRGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIF 402
            LRRG  ++CEAQ+TA  +P V D+TW SLVL +  PV V+FWAPWCGPC+MI PI++EL+++Y G+ K YK+NTDESP+   +YG+RSIPT+MIF
Sbjct:   61 LRRG--VICEAQDTATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPATPGQYGVRSIPTIMIF 153          
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: TRXM_WHEAT (Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 2.499e-30
Identity = 57/95 (60.00%), Postives = 73/95 (76.84%), Query Frame = 1
Query:  121 RRGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405
            RR ++ VC+ +    EV    +  W ++V+   SPVLVEFWAPWCGPCRMI P+IDEL+K YVGK+KC KVNTD+ P+IA+ YGIRSIPTV++FK
Sbjct:   54 RRPSRFVCKCKNVVDEVIVADEKNWDNMVIACESPVLVEFWAPWCGPCRMIAPVIDELAKDYVGKIKCCKVNTDDCPNIASTYGIRSIPTVLMFK 148          
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: TRXM_SPIOL (Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 129.798 bits (325), Expect = 4.262e-30
Identity = 55/94 (58.51%), Postives = 74/94 (78.72%), Query Frame = 1
Query:  124 RGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405
            R + +VC+A E   EV  V D++W+  VL+S  PV+V+FWAPWCGPC++I P+IDEL+K+Y GK+  YK+NTDE+P IAT+Y IRSIPTV+ FK
Sbjct:   61 RYSSVVCKASEAVKEVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFK 154          
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: TRXM_MAIZE (Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.154e-29
Identity = 54/89 (60.67%), Postives = 68/89 (76.40%), Query Frame = 1
Query:  139 VCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405
            VC+++    EV    +  W  LV+   +PVLVEFWAPWCGPCRMI P+IDEL+K Y GK+ C KVNTD+SP++A+ YGIRSIPTV+IFK
Sbjct:   51 VCQSKNAVDEVVVADEKNWDGLVMACETPVLVEFWAPWCGPCRMIAPVIDELAKDYAGKITCCKVNTDDSPNVASTYGIRSIPTVLIFK 139          
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO1_ANASP (Thioredoxin-1 OS=Anabaena sp. (strain PCC 7120) GN=trxA PE=3 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 1.980e-27
Identity = 51/76 (67.11%), Postives = 67/76 (88.16%), Query Frame = 1
Query:  178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405
            VTD+T++  VLDS  PVLV+FWAPWCGPCRM+ P++DE+++QY GK+K  KVNTDE+P +A++YGIRSIPT+MIFK
Sbjct:    7 VTDSTFKQEVLDSDVPVLVDFWAPWCGPCRMVAPVVDEIAQQYEGKIKVVKVNTDENPQVASQYGIRSIPTLMIFK 82          
The following BLAST results are available for this feature:
BLAST of CX287332 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
TRXM4_ARATH1.237e-3755.47Thioredoxin M-type 4, chloroplastic OS=Arabidopsis... [more]
TRXM_BRANA7.025e-3362.11Thioredoxin M-type, chloroplastic OS=Brassica napu... [more]
TRXM_PEA2.669e-3265.56Thioredoxin M-type, chloroplastic OS=Pisum sativum... [more]
TRXM_ORYSJ3.486e-3262.50Thioredoxin M-type, chloroplastic OS=Oryza sativa ... [more]
TRXM2_ARATH5.947e-3248.87Thioredoxin M-type 2, chloroplastic OS=Arabidopsis... [more]
TRXM1_ARATH5.947e-3261.05Thioredoxin M-type 1, chloroplastic OS=Arabidopsis... [more]
TRXM_WHEAT2.499e-3060.00Thioredoxin M-type, chloroplastic OS=Triticum aest... [more]
TRXM_SPIOL4.262e-3058.51Thioredoxin M-type, chloroplastic OS=Spinacia oler... [more]
TRXM_MAIZE6.154e-2960.67Thioredoxin M-type, chloroplastic OS=Zea mays GN=T... [more]
THIO1_ANASP1.980e-2767.11Thioredoxin-1 OS=Anabaena sp. (strain PCC 7120) GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01008D05SK Veg1 Citrus clementina cDNA clone C01008D05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287332 ID=CX287332|Name=CX287332|organism=Citrus clementina|type=EST|length=406bp
GTCTTCTTCCTTAATTCGATCTCTGGCCGTCGGAAATTCGCCGAGTTCAA
GGGCCTTAAGGTCAGACCTGTTCGCTCGTTCGGATCGGTGAGTCAGGGTT
CGAGTTCGAGCTTCAGACTCCGTCGCGGTGCGCAAATCGTGTGCGAGGCT
CAAGAAACTGCCGTTGAAGTGCCTGCTGTGACAGATGCAACATGGCAATC
ACTTGTTCTTGACTCTGGATCACCTGTGCTTGTTGAATTCTGGGCTCCAT
GGTGCGGGCCTTGCCGGATGATCCACCCTATTATTGATGAGCTATCAAAG
CAATATGTGGGGAAGCTAAAATGCTATAAGGTTAATACTGATGAGAGTCC
TTCAATTGCTACTAGATATGGAATTAGGAGCATCCCAACTGTCATGATAT
TTAAGA
back to top