CX287333

Overview
NameCX287333
Unique NameCX287333
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length381
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9265 contig Ccv1_Contig9265:34..414. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287333 vs. ExPASy Swiss-Prot
Match: TOM7A_ARATH (Mitochondrial import receptor subunit TOM7-1 OS=Arabidopsis thaliana GN=TOM7-1 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.055e-20
Identity = 45/75 (60.00%), Postives = 58/75 (77.33%), Query Frame = 3
Query:   48 MGSRVTLRT---KGKGVKGAKASEEKSMIDSFKEWSTWTMKKAKADTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 263
            M S ++L+    KGKG KGA +S++KS  D  KEW+ W++KKAK  THYGFIPL+I +GMNSDPKP ++QLLSPV
Sbjct:    1 MESTISLKVNKGKGKGSKGASSSDDKSKFDVVKEWTNWSLKKAKVVTHYGFIPLVIFVGMNSDPKPHLFQLLSPV 75          
BLAST of CX287333 vs. ExPASy Swiss-Prot
Match: TOM7B_ARATH (Mitochondrial import receptor subunit TOM7-2 OS=Arabidopsis thaliana GN=TOM7-2 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.416e-17
Identity = 41/77 (53.25%), Postives = 53/77 (68.83%), Query Frame = 3
Query:   48 MGSRVTLRTKGK-----GVKGAKASEEKSMIDSFKEWSTWTMKKAKADTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 263
            M ++ TL+ KGK     G   + +S   S    FK+W+ W+++KAK  THYGFIPLIIIIGMNSDPKP ++ LLSPV
Sbjct:    1 MAAKSTLKIKGKAKPSKGSSSSSSSSASSKYKVFKDWTNWSLQKAKVATHYGFIPLIIIIGMNSDPKPHLFHLLSPV 77          
BLAST of CX287333 vs. ExPASy Swiss-Prot
Match: TOM7A_SOLTU (Mitochondrial import receptor subunit TOM7-1 OS=Solanum tuberosum GN=TOM7-1 PE=3 SV=3)

HSP 1 Score: 85.1149 bits (209), Expect = 1.207e-16
Identity = 43/71 (60.56%), Postives = 52/71 (73.24%), Query Frame = 3
Query:   66 LRTKGKGVKGAKASEEK----SMIDSF-KEWSTWTMKKAKADTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 263
            L+ KGK  K A A++E     +++  F KEW TWT KKAK  THYGFIPL+IIIGMNS+PKP + QLLSPV
Sbjct:    2 LKPKGKNTKKAAAADEDDGAVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72          
The following BLAST results are available for this feature:
BLAST of CX287333 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
TOM7A_ARATH1.055e-2060.00Mitochondrial import receptor subunit TOM7-1 OS=Ar... [more]
TOM7B_ARATH5.416e-1753.25Mitochondrial import receptor subunit TOM7-2 OS=Ar... [more]
TOM7A_SOLTU1.207e-1660.56Mitochondrial import receptor subunit TOM7-1 OS=So... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01008D07SK Veg1 Citrus clementina cDNA clone C01008D07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287333 ID=CX287333|Name=CX287333|organism=Citrus clementina|type=EST|length=381bp
ACAACGTTCAAGCCGTTCACCGCAGCAGGTCAAGATTTGAGGAGAAAATG
GGTTCTAGAGTAACACTTAGGACCAAAGGCAAGGGCGTGAAGGGAGCAAA
GGCATCAGAGGAGAAATCAATGATCGATTCTTTCAAAGAGTGGAGCACTT
GGACCATGAAAAAGGCTAAAGCGGACACTCACTATGGATTTATTCCTCTT
ATCATCATTATCGGCATGAATTCTGATCCCAAGCCCCAAGTCTATCAGCT
CCTCAGCCCCGTTTGATCTCCATACTTGACTCTTCCTTTTCTTTTGATGT
CAAACAAAATAGTTATTGACATGCTGTGCCTTCCTATTTGTCGAATCTAC
ATGAATTGAATGTTTTAGGAGTTTTGGTTTC
back to top