CX287418

Overview
NameCX287418
Unique NameCX287418
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length353
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX287418 vs. ExPASy Swiss-Prot
Match: LOX23_HORVU (Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare GN=LOX2.3 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 2.683e-24
Identity = 49/74 (66.22%), Postives = 61/74 (82.43%), Query Frame = 1
Query:    1 DEEYLGKEIEPAWREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 222
            DEEY+G+  EPAW  +P++ AAFEKF G+L E EG ID RN +P+ +NR GAG+VPYELLKPFSEPGVTG+G+P
Sbjct:  818 DEEYMGEYAEPAWLAEPMVKAAFEKFSGRLKEAEGTIDMRNNNPENKNRCGAGIVPYELLKPFSEPGVTGRGIP 891          
BLAST of CX287418 vs. ExPASy Swiss-Prot
Match: LOX2_ARATH (Lipoxygenase 2, chloroplastic OS=Arabidopsis thaliana GN=LOX2 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 8.631e-23
Identity = 49/75 (65.33%), Postives = 60/75 (80.00%), Query Frame = 1
Query:    1 DEEYLGKEIEPAWREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVPY 225
            DEEY+G++ E +W  +PVINAAFE+F+GKL  LEG+ID RN +  L+NR GAG+V YELLKP SE GVTG GVPY
Sbjct:  818 DEEYIGEQQEASWANEPVINAAFERFKGKLQYLEGVIDERNVNITLKNRAGAGVVKYELLKPTSEHGVTGMGVPY 892          
BLAST of CX287418 vs. ExPASy Swiss-Prot
Match: LOXC1_ORYSJ (Lipoxygenase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX1 PE=2 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 2.599e-19
Identity = 41/74 (55.41%), Postives = 54/74 (72.97%), Query Frame = 1
Query:    1 DEEYLGKEIEPAWREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 222
            DEEYLG E    W  D  + AA++ F  +L E+EG+ID RN D KL+NR GAG++PY+L+KPFS+ GVTG G+P
Sbjct:  846 DEEYLGGEQTRPWNSDAAVQAAYDGFAARLKEIEGVIDGRNKDRKLKNRCGAGILPYQLMKPFSDSGVTGMGIP 919          
BLAST of CX287418 vs. ExPASy Swiss-Prot
Match: LOXC2_ORYSJ (Probable lipoxygenase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX2 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 5.789e-19
Identity = 41/74 (55.41%), Postives = 53/74 (71.62%), Query Frame = 1
Query:    1 DEEYLGKEIEPAWREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 222
            DEEYLG E    W  D  + AA+  F  +L E+EG+ID RN D KL+NR GAG++PY+L+KPFS+ GVTG G+P
Sbjct:  863 DEEYLGGEQTRPWNSDAAVQAAYAGFTARLKEIEGVIDGRNKDRKLKNRCGAGILPYQLMKPFSDAGVTGMGIP 936          
BLAST of CX287418 vs. ExPASy Swiss-Prot
Match: LOX5_ORYSJ (Putative lipoxygenase 5 OS=Oryza sativa subsp. japonica GN=Os04g0447100 PE=3 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 6.624e-15
Identity = 38/74 (51.35%), Postives = 48/74 (64.86%), Query Frame = 1
Query:    1 DEEYLGKEIEPAWREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 222
            DEEYLG+  + AW  DP   AA  +F   +   E  I+ RNADP  RNR GAG++PYEL+ P S PG+T +GVP
Sbjct:  821 DEEYLGERPDEAWTADPAALAAAREFAADVRRAEEEIERRNADPSRRNRCGAGVLPYELMAPSSGPGITCRGVP 894          
BLAST of CX287418 vs. ExPASy Swiss-Prot
Match: LOX3_ARATH (Lipoxygenase 3, chloroplastic OS=Arabidopsis thaliana GN=LOX3 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.517e-14
Identity = 40/75 (53.33%), Postives = 51/75 (68.00%), Query Frame = 1
Query:    1 DEEYLGKEIEPA-WREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 222
            DEEY+G+  +P+ W  D  I  AF  F  ++  +E  I+ RNADP  RNR GAG++PYELL P SEPGVT +GVP
Sbjct:  840 DEEYIGERQQPSIWTGDAEIVEAFYGFAAEIGRIEKEIEKRNADPDRRNRCGAGVLPYELLVPSSEPGVTCRGVP 914          
BLAST of CX287418 vs. ExPASy Swiss-Prot
Match: LOX4_ARATH (Lipoxygenase 4, chloroplastic OS=Arabidopsis thaliana GN=LOX4 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.293e-14
Identity = 39/75 (52.00%), Postives = 50/75 (66.67%), Query Frame = 1
Query:    1 DEEYLGKEIEPA-WREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 222
            DEEY+G+  +P+ W  D  I  AF  F  ++  +E  ID RN DP  RNR GAG++PYEL+ P SEPGVT +GVP
Sbjct:  847 DEEYIGERQQPSIWTGDAEIVDAFYGFSAEIGRIEKEIDKRNRDPSRRNRCGAGVLPYELMAPSSEPGVTCRGVP 921          
BLAST of CX287418 vs. ExPASy Swiss-Prot
Match: LOX6_ARATH (Lipoxygenase 6, choloroplastic OS=Arabidopsis thaliana GN=LOX6 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.249e-13
Identity = 38/76 (50.00%), Postives = 51/76 (67.11%), Query Frame = 1
Query:    1 DEEYLG--KEIEPAWREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 222
            DEEYL   +E++  W +D  +   F KF  +L+++E  I+ RN D KL+NR GAGM PYELL P S  GVTG+G+P
Sbjct:  837 DEEYLIELREVQRHWFQDEQVVKYFNKFSEELVKIEKTINERNKDKKLKNRTGAGMPPYELLLPTSPHGVTGRGIP 912          
BLAST of CX287418 vs. ExPASy Swiss-Prot
Match: LOXX_SOYBN (Seed lipoxygenase OS=Glycine max GN=LOX1.4 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.747e-13
Identity = 37/74 (50.00%), Postives = 46/74 (62.16%), Query Frame = 1
Query:    1 DEEYLGKEIEPAWREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 222
            DE YLG+   P W  D     AF++F  KL  +EG I+ARN+DP LRNR G   +PY LL   SE G+T KG+P
Sbjct:  786 DEIYLGERETPNWTTDKKALEAFKRFGSKLTGIEGKINARNSDPSLRNRTGPVQLPYTLLHRSSEEGLTFKGIP 859          
BLAST of CX287418 vs. ExPASy Swiss-Prot
Match: LOX21_HORVU (Lipoxygenase 2.1, chloroplastic OS=Hordeum vulgare GN=LOX2.1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.381e-12
Identity = 33/62 (53.23%), Postives = 43/62 (69.35%), Query Frame = 1
Query:    1 DEEYLGKEIEPAWREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKP 186
            DEEY+G   EPAW +D VIN AFE+F+    ++   +D  N DP  +NR+GAGMVPY LL+P
Sbjct:  848 DEEYMGTHEEPAWTKDGVINQAFEEFKESTRKIVEQVDEWNNDPDRKNRHGAGMVPYVLLRP 909          
The following BLAST results are available for this feature:
BLAST of CX287418 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
LOX23_HORVU2.683e-2466.22Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare... [more]
LOX2_ARATH8.631e-2365.33Lipoxygenase 2, chloroplastic OS=Arabidopsis thali... [more]
LOXC1_ORYSJ2.599e-1955.41Lipoxygenase 7, chloroplastic OS=Oryza sativa subs... [more]
LOXC2_ORYSJ5.789e-1955.41Probable lipoxygenase 8, chloroplastic OS=Oryza sa... [more]
LOX5_ORYSJ6.624e-1551.35Putative lipoxygenase 5 OS=Oryza sativa subsp. jap... [more]
LOX3_ARATH2.517e-1453.33Lipoxygenase 3, chloroplastic OS=Arabidopsis thali... [more]
LOX4_ARATH4.293e-1452.00Lipoxygenase 4, chloroplastic OS=Arabidopsis thali... [more]
LOX6_ARATH1.249e-1350.00Lipoxygenase 6, choloroplastic OS=Arabidopsis thal... [more]
LOXX_SOYBN4.747e-1350.00Seed lipoxygenase OS=Glycine max GN=LOX1.4 PE=1 SV... [more]
LOX21_HORVU1.381e-1253.23Lipoxygenase 2.1, chloroplastic OS=Hordeum vulgare... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01009C12SK Veg1 Citrus clementina cDNA clone C01009C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287418 ID=CX287418; Name=CX287418; organism=Citrus clementina; type=EST; length=353bp
GATGAGGAGTATTTAGGAAAAGAAATAGAGCCAGCATGGCGTGAGGATCC
GGTTATAAATGCAGCATTTGAAAAGTTTAGAGGCAAGTTAATGGAGCTTG
AAGGGATTATTGATGCAAGGAATGCAGATCCCAAGTTGAGGAATAGAAAT
GGAGCTGGGATGGTGCCATATGAGCTCTTGAAGCCATTTTCGGAACCTGG
TGTTACAGGAAAAGGAGTTCCGTACAGCATCTCTATCTAGAGTTGAAAAT
GTTGTTGCAATCGCTCGAATGTTGTATCAATAAAAACTTTTGAGAATGAG
TTCAAGAATGAATCAAATAAATTGCAGTTAATGTTAAAAAAAAAAAAAAA
AAA
back to top