CX287658

Overview
NameCX287658
Unique NameCX287658
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length431
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10742 contig Ccv1_Contig10742:150..580. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287658 vs. ExPASy Swiss-Prot
Match: ANAN_ANACO (Ananain OS=Ananas comosus GN=AN1 PE=1 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 2.745e-35
Identity = 69/138 (50.00%), Postives = 92/138 (66.67%), Query Frame = 1
Query:   16 EKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRXXXXXXFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSE 429
            E+WMA++GR YKD  EK +R +IFK N+ +IE  N     +Y LG NQF+D+TN+EF A YTG  +P    R        + ++ ++ VP S+DWRD GAVT +KNQ  CG CWAFA++A VE I KI+ GNL+ LSE
Sbjct:   38 EEWMAEYGRVYKDNDEKMLRFQIFKNNVNHIETFNNRNGNSYTLGINQFTDMTNNEFVAQYTGLSLPLNIKR---EPVVSFDDVDISSVPQSIDWRDSGAVTSVKNQGRCGSCWAFASIATVESIYKIKRGNLVSLSE 172          
BLAST of CX287658 vs. ExPASy Swiss-Prot
Match: XCP1_ARATH (Xylem cysteine proteinase 1 OS=Arabidopsis thaliana GN=XCP1 PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.779e-34
Identity = 68/143 (47.55%), Postives = 100/143 (69.93%), Query Frame = 1
Query:    1 VVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRXXXXXXFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSE 429
            ++E+ E WM++H ++YK   EK  R ++F+ENL +I++ N E N +Y LG N+F+DLT++EF+  Y G   P  S +      F+Y+++  TD+P S+DWR KGAV P+K+Q +CG CWAF+ VAAVEGI +I +GNL  LSE
Sbjct:   47 LLELFESWMSEHSKAYKSVEEKVHRFEVFRENLMHIDQRNNEIN-SYWLGLNEFADLTHEEFKGRYLGLAKPQFSRKRQPSANFRYRDI--TDLPKSVDWRKKGAVAPVKDQGQCGSCWAFSTVAAVEGINQITTGNLSSLSE 186          
BLAST of CX287658 vs. ExPASy Swiss-Prot
Match: BROM1_ANACO (Fruit bromelain OS=Ananas comosus PE=1 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 8.831e-34
Identity = 67/138 (48.55%), Postives = 92/138 (66.67%), Query Frame = 1
Query:   16 EKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRXXXXXXFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSE 429
            E+WMA++GR YKD+ EK  R +IFK N+++IE  N     +Y LG NQF+D+T  EF A YTG  +P    R        + +++++ VP S+DWRD GAV  +KNQ  CG CW+FAA+A VEGI KI++G L+ LSE
Sbjct:   38 EEWMAEYGRVYKDDDEKMRRFQIFKNNVKHIETFNSRNENSYTLGINQFTDMTKSEFVAQYTGVSLPLNIER---EPVVSFDDVNISAVPQSIDWRDYGAVNEVKNQNPCGSCWSFAAIATVEGIYKIKTGYLVSLSE 172          
BLAST of CX287658 vs. ExPASy Swiss-Prot
Match: PAPA4_CARPA (Papaya proteinase 4 OS=Carica papaya PE=1 SV=3)

HSP 1 Score: 135.961 bits (341), Expect = 6.328e-32
Identity = 67/143 (46.85%), Postives = 95/143 (66.43%), Query Frame = 1
Query:    1 VVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRXXXXXXFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSE 429
            ++++   WM +H ++YK+  EK  R +IFK+NL+YI++ NK  N  Y LG N+FSDL+NDEF+  Y G     P          ++ N  + D+P S+DWR KGAVTP+K+Q  C  CWAF+ VA VEGI KI++GNL++LSE
Sbjct:   44 LIQLFNSWMLKHNKNYKNVDEKLYRFEIFKDNLKYIDERNKMING-YWLGLNEFSDLSNDEFKEKYVG---SLPEDYTNQPYDEEFVNEDIVDLPESVDWRAKGAVTPVKHQGYCESCWAFSTVATVEGINKIKTGNLVELSE 182          
BLAST of CX287658 vs. ExPASy Swiss-Prot
Match: CPR2_ARATH (Probable cysteine proteinase At3g43960 OS=Arabidopsis thaliana GN=At3g43960 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 6.328e-32
Identity = 69/144 (47.92%), Postives = 95/144 (65.97%), Query Frame = 1
Query:    1 VVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRXXXXXXFKYQNLSMTDVPTSLDWRDKGAVTP-IKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSE 429
            V+ ++E+W+ ++G++Y    EKE R KIFK+NL+ IE+ N + NR+Y+ G N+FSDLT DEF+A Y G KM   S         +YQ      +P  +DWR++GAV P +K Q ECG CWAFAA  AVEGI +I +G L+ LSE
Sbjct:   37 VLTMYEQWLVENGKNYNGLGEKERRFKIFKDNLKRIEEHNSDPNRSYERGLNKFSDLTADEFQASYLGGKMEKKS---LSDVAERYQYKEGDVLPDEVDWRERGAVVPRVKRQGECGSCWAFAATGAVEGINQITTGELVSLSE 177          
BLAST of CX287658 vs. ExPASy Swiss-Prot
Match: PAPA3_CARPA (Caricain OS=Carica papaya PE=1 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 3.141e-31
Identity = 63/143 (44.06%), Postives = 95/143 (66.43%), Query Frame = 1
Query:    1 VVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRXXXXXXFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSE 429
            ++++   WM  H + Y++  EK  R +IFK+NL YI++ NK+ N +Y LG N+F+DL+NDEF   Y G  + +   +       ++ N    ++P ++DWR KGAVTP+++Q  CG CWAF+AVA VEGI KIR+G L++LSE
Sbjct:   44 LIQLFNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDETNKKNN-SYWLGLNEFADLSNDEFNEKYVGSLIDATIEQSYDE---EFINEDTVNLPENVDWRKKGAVTPVRHQGSCGSCWAFSAVATVEGINKIRTGKLVELSE 182          
BLAST of CX287658 vs. ExPASy Swiss-Prot
Match: PAPA1_CARPA (Papain OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 3.141e-31
Identity = 65/143 (45.45%), Postives = 95/143 (66.43%), Query Frame = 1
Query:    1 VVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRXXXXXXFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSE 429
            ++++ E WM +H + YK+  EK  R +IFK+NL+YI++ NK+ N +Y LG N F+D++NDEF+  YTG    + ++        +  N    ++P  +DWR KGAVTP+KNQ  CG CWAF+AV  +EGI KIR+GNL + SE
Sbjct:   44 LIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNN-SYWLGLNVFADMSNDEFKEKYTG--SIAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSE 183          
BLAST of CX287658 vs. ExPASy Swiss-Prot
Match: PAPA2_CARPA (Chymopapain OS=Carica papaya PE=1 SV=2)

HSP 1 Score: 132.88 bits (333), Expect = 5.357e-31
Identity = 65/144 (45.14%), Postives = 95/144 (65.97%), Query Frame = 1
Query:    1 VVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPS-PSHRXXXXXXFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSE 429
            ++++ + WM +H + Y+   EK  R +IF++NL YI++ NK+ N +Y LG N F+DL+NDEF+  Y G+               F Y+++  T+ P S+DWR KGAVTP+KNQ  CG CWAF+ +A VEGI KI +GNL++LSE
Sbjct:   44 LIQLFDSWMLKHNKIYESIDEKIYRFEIFRDNLMYIDETNKKNN-SYWLGLNGFADLSNDEFKKKYVGFVAEDFTGLEHFDNEDFTYKHV--TNYPQSIDWRAKGAVTPVKNQGACGSCWAFSTIATVEGINKIVTGNLLELSE 184          
BLAST of CX287658 vs. ExPASy Swiss-Prot
Match: ACTN_ACTDE (Actinidain OS=Actinidia deliciosa PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 5.923e-30
Identity = 65/143 (45.45%), Postives = 93/143 (65.03%), Query Frame = 1
Query:    1 VVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRXXXXXXFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSE 429
            V  ++E W+ ++G+SY    E E R +IFKE L +I++ N + NR+YK+G NQF+DLT++EFR+ Y G+   S   +       +Y+      +P+ +DWR  GAV  IK+Q ECG CWAF+A+A VEGI KI +G LI LSE
Sbjct:   38 VKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSNKTKVSN----RYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSE 176          
BLAST of CX287658 vs. ExPASy Swiss-Prot
Match: RD21A_ARATH (Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 7.736e-30
Identity = 63/145 (43.45%), Postives = 95/145 (65.52%), Query Frame = 1
Query:    1 VVEIHEKWMAQHGRSYKDE--LEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRXXXXXXFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSE 429
            V+ I+E W+ +HG++      +EK+ R +IFK+NL ++++ N E N +Y+LG  +F+DLTNDE+R+ Y G KM     R       +Y+     ++P S+DWR KGAV  +K+Q  CG CWAF+ + AVEGI +I +G+LI LSE
Sbjct:   46 VMSIYEAWLVKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHN-EKNLSYRLGLTRFADLTNDEYRSKYLGAKMEKKGERRTS---LRYEARVGDELPESIDWRKKGAVAEVKDQGGCGSCWAFSTIGAVEGINQIVTGDLITLSE 186          
The following BLAST results are available for this feature:
BLAST of CX287658 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
ANAN_ANACO2.745e-3550.00Ananain OS=Ananas comosus GN=AN1 PE=1 SV=2[more]
XCP1_ARATH1.779e-3447.55Xylem cysteine proteinase 1 OS=Arabidopsis thalian... [more]
BROM1_ANACO8.831e-3448.55Fruit bromelain OS=Ananas comosus PE=1 SV=1[more]
PAPA4_CARPA6.328e-3246.85Papaya proteinase 4 OS=Carica papaya PE=1 SV=3[more]
CPR2_ARATH6.328e-3247.92Probable cysteine proteinase At3g43960 OS=Arabidop... [more]
PAPA3_CARPA3.141e-3144.06Caricain OS=Carica papaya PE=1 SV=2[more]
PAPA1_CARPA3.141e-3145.45Papain OS=Carica papaya PE=1 SV=1[more]
PAPA2_CARPA5.357e-3145.14Chymopapain OS=Carica papaya PE=1 SV=2[more]
ACTN_ACTDE5.923e-3045.45Actinidain OS=Actinidia deliciosa PE=1 SV=1[more]
RD21A_ARATH7.736e-3043.45Cysteine proteinase RD21a OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01011H11SK Veg1 Citrus clementina cDNA clone C01011H11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287658 ID=CX287658; Name=CX287658; organism=Citrus clementina; type=EST; length=431bp
GTTGTTGAGATACACGAAAAATGGATGGCTCAACACGGACGCAGTTATAA
GGACGAGCTGGAGAAGGAAATGCGGCTTAAGATATTCAAGGAGAACCTTG
AATACATTGAGAAAGCCAATAAGGAGGGGAACCGGACGTACAAGTTAGGC
ACCAATCAGTTTTCGGACTTAACCAACGATGAGTTTCGTGCTTTATACAC
CGGATACAAGATGCCAAGCCCGAGCCATCGATCCACAACATCATCCACCT
TCAAGTATCAAAACCTGTCCATGACTGATGTTCCAACTAGCCTGGACTGG
CGGGACAAAGGAGCTGTCACTCCTATCAAGAACCAGAAAGAATGCGGATG
CTGTTGGGCATTTGCAGCGGTGGCGGCAGTGGAAGGGATCACTAAAATTC
GCAGTGGTAATCTGATTCAACTTTCGGAGCA
back to top