CX288486

Overview
NameCX288486
Unique NameCX288486
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length484
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX288486 vs. ExPASy Swiss-Prot
Match: RK35_SPIOL (50S ribosomal protein L35, chloroplastic OS=Spinacia oleracea GN=RPL35 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.011e-32
Identity = 72/100 (72.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:   51 PLLFRHNNFPT---TVTQNKPQTVTVFAAKGYKMKTHKASAKRFRVTGKGKILRRRAGKQHLLAKKNTKRKLRLSKMHEVSRSDYDNVIGCLPYLKVNRQ 341
            P++ ++    T   +V+ + P + TVFAAKGYKMKTHKASAKRFRVTGKGKI+RRRAGKQHLLAKKNTKRK RLSK+ +V RSDYDNVIG LPYLKVNR+
Sbjct:   60 PIVLKNKRISTVDSSVSTSSP-SFTVFAAKGYKMKTHKASAKRFRVTGKGKIVRRRAGKQHLLAKKNTKRKNRLSKLIQVDRSDYDNVIGALPYLKVNRK 158          
BLAST of CX288486 vs. ExPASy Swiss-Prot
Match: RL35_ANAVT (50S ribosomal protein L35 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpmI PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 7.529e-12
Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 3
Query:  138 KMKTHKASAKRFRVTGKGKILRRRAGKQHLLAKKNTKRKLRLSKMHEVSRSDYDNVIGCLPYL 326
            K+KT KA+AKRFR TG GKI+RR+A K HLL  K T +K + SKM  V+  D +NV   LPYL
Sbjct:    3 KLKTRKAAAKRFRATGTGKIVRRKAFKNHLLEHKTTNKKRQFSKMAIVNERDEENVRLMLPYL 65          
BLAST of CX288486 vs. ExPASy Swiss-Prot
Match: RL35_ANASP (50S ribosomal protein L35 OS=Anabaena sp. (strain PCC 7120) GN=rpmI PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 7.529e-12
Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 3
Query:  138 KMKTHKASAKRFRVTGKGKILRRRAGKQHLLAKKNTKRKLRLSKMHEVSRSDYDNVIGCLPYL 326
            K+KT KA+AKRFR TG GKI+RR+A K HLL  K T +K + SKM  V+  D +NV   LPYL
Sbjct:    3 KLKTRKAAAKRFRATGTGKIVRRKAFKNHLLEHKTTNKKRQFSKMAIVNERDEENVRLMLPYL 65          
BLAST of CX288486 vs. ExPASy Swiss-Prot
Match: RL35_NOSP7 (50S ribosomal protein L35 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rpmI PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 8.325e-11
Identity = 35/63 (55.56%), Postives = 43/63 (68.25%), Query Frame = 3
Query:  138 KMKTHKASAKRFRVTGKGKILRRRAGKQHLLAKKNTKRKLRLSKMHEVSRSDYDNVIGCLPYL 326
            K+KT KA+AKRFR TG GKI+RR+AGK HLL  K++ +K  +SK   V   D  NV   LPYL
Sbjct:    3 KLKTRKAAAKRFRATGTGKIVRRKAGKSHLLEHKSSDKKRSMSKTTLVHERDELNVRLMLPYL 65          
The following BLAST results are available for this feature:
BLAST of CX288486 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
RK35_SPIOL1.011e-3272.0050S ribosomal protein L35, chloroplastic OS=Spinac... [more]
RL35_ANAVT7.529e-1257.1450S ribosomal protein L35 OS=Anabaena variabilis (... [more]
RL35_ANASP7.529e-1257.1450S ribosomal protein L35 OS=Anabaena sp. (strain ... [more]
RL35_NOSP78.325e-1155.5650S ribosomal protein L35 OS=Nostoc punctiforme (s... [more]
back to top
Properties
Property NameValue
Genbank descriptionC02001A01SK IF1 Citrus clementina cDNA clone C02001A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288486 ID=CX288486|Name=CX288486|organism=Citrus clementina|type=EST|length=484bp
AGCTTAACAACTCGCTCAGACTCAATTCAAGCTACAGCATTTCCGCCTCT
CCTTTACTCTTCCGTCATAACAACTTCCCCACAACAGTTACTCAAAATAA
GCCTCAAACGGTCACTGTTTTTGCCGCAAAAGGTTACAAAATGAAAACCC
ACAAGGCATCCGCGAAGAGGTTTAGGGTGACTGGTAAAGGAAAAATATTG
AGGAGGAGAGCTGGAAAGCAGCATTTATTAGCTAAGAAAAACACTAAGAG
AAAATTACGCCTCTCTAAAATGCACGAGGTTAGCCGAAGTGACTACGACA
ATGTTATAGGTTGCTTGCCATATCTGAAGGTTAACAGGCAAGCAAAGTAG
AAGTGATTTTCACAGTTTGCAGAAGACCTATGTAATTTCCGTTCGCCTGA
ATTTCTCACATTTTGTTGTCAGCAAACAACGAAGTGCTAGCAATTGTTTT
ATTTACCCTAATTGATCAAAAAAAAAAAAAAAAA
back to top