CX288489

Overview
NameCX288489
Unique NameCX288489
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length434
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10330 contig Ccv1_Contig10330:134..567. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX288489 vs. ExPASy Swiss-Prot
Match: TBA2_ARATH (Tubulin alpha-2/alpha-4 chain OS=Arabidopsis thaliana GN=TUBA2 PE=2 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 4.296e-76
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 1
Query:    1 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 402
            HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV
Sbjct:    8 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 141          
BLAST of CX288489 vs. ExPASy Swiss-Prot
Match: TBA_PRUDU (Tubulin alpha chain OS=Prunus dulcis GN=TUBA PE=2 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 1.250e-75
Identity = 133/134 (99.25%), Postives = 133/134 (99.25%), Query Frame = 1
Query:    1 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 402
            HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV
Sbjct:    8 HIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 141          
BLAST of CX288489 vs. ExPASy Swiss-Prot
Match: TBA6_ARATH (Tubulin alpha-6 chain OS=Arabidopsis thaliana GN=TUBA6 PE=2 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 1.250e-75
Identity = 133/134 (99.25%), Postives = 133/134 (99.25%), Query Frame = 1
Query:    1 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 402
            HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV
Sbjct:    8 HIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 141          
BLAST of CX288489 vs. ExPASy Swiss-Prot
Match: TBA3_HORVU (Tubulin alpha-3 chain OS=Hordeum vulgare GN=TUBA3 PE=2 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 1.250e-75
Identity = 133/134 (99.25%), Postives = 133/134 (99.25%), Query Frame = 1
Query:    1 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 402
            HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV
Sbjct:    8 HIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 141          
BLAST of CX288489 vs. ExPASy Swiss-Prot
Match: TBA4_GOSHI (Tubulin alpha-4 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 1.633e-75
Identity = 133/134 (99.25%), Postives = 133/134 (99.25%), Query Frame = 1
Query:    1 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 402
            HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV
Sbjct:    8 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 141          
BLAST of CX288489 vs. ExPASy Swiss-Prot
Match: TBA2_GOSHI (Tubulin alpha-2 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 1.633e-75
Identity = 133/134 (99.25%), Postives = 133/134 (99.25%), Query Frame = 1
Query:    1 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 402
            HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV
Sbjct:    8 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 141          
BLAST of CX288489 vs. ExPASy Swiss-Prot
Match: TBA_DAUCA (Tubulin alpha chain OS=Daucus carota GN=TBA PE=2 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 2.785e-75
Identity = 131/134 (97.76%), Postives = 134/134 (100.00%), Query Frame = 1
Query:    1 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 402
            HIGQAGIQ+GNACWELYCLEHGIQP+GQMPSDKTVGGGDDAFNTFFSETGAGKHVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV
Sbjct:    8 HIGQAGIQIGNACWELYCLEHGIQPNGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 141          
BLAST of CX288489 vs. ExPASy Swiss-Prot
Match: TBA_CHLVU (Tubulin alpha chain OS=Chlorella vulgaris GN=TUBA PE=3 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 3.637e-75
Identity = 131/134 (97.76%), Postives = 133/134 (99.25%), Query Frame = 1
Query:    1 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 402
            HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGKHVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV
Sbjct:    8 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGKHVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 141          
BLAST of CX288489 vs. ExPASy Swiss-Prot
Match: TBA1_PEA (Tubulin alpha-1 chain OS=Pisum sativum GN=TUBA1 PE=3 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 4.750e-75
Identity = 132/134 (98.51%), Postives = 132/134 (98.51%), Query Frame = 1
Query:    1 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 402
            HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV
Sbjct:    8 HIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 141          
BLAST of CX288489 vs. ExPASy Swiss-Prot
Match: TBA2_ORYSJ (Tubulin alpha-2 chain OS=Oryza sativa subsp. japonica GN=TUBA PE=2 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 6.204e-75
Identity = 132/134 (98.51%), Postives = 132/134 (98.51%), Query Frame = 1
Query:    1 HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 402
            HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV
Sbjct:    8 HIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV 141          
The following BLAST results are available for this feature:
BLAST of CX288489 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 407
Match NameE-valueIdentityDescription
TBA2_ARATH4.296e-76100.00Tubulin alpha-2/alpha-4 chain OS=Arabidopsis thali... [more]
TBA_PRUDU1.250e-7599.25Tubulin alpha chain OS=Prunus dulcis GN=TUBA PE=2 ... [more]
TBA6_ARATH1.250e-7599.25Tubulin alpha-6 chain OS=Arabidopsis thaliana GN=T... [more]
TBA3_HORVU1.250e-7599.25Tubulin alpha-3 chain OS=Hordeum vulgare GN=TUBA3 ... [more]
TBA4_GOSHI1.633e-7599.25Tubulin alpha-4 chain OS=Gossypium hirsutum PE=2 S... [more]
TBA2_GOSHI1.633e-7599.25Tubulin alpha-2 chain OS=Gossypium hirsutum PE=2 S... [more]
TBA_DAUCA2.785e-7597.76Tubulin alpha chain OS=Daucus carota GN=TBA PE=2 S... [more]
TBA_CHLVU3.637e-7597.76Tubulin alpha chain OS=Chlorella vulgaris GN=TUBA ... [more]
TBA1_PEA4.750e-7598.51Tubulin alpha-1 chain OS=Pisum sativum GN=TUBA1 PE... [more]
TBA2_ORYSJ6.204e-7598.51Tubulin alpha-2 chain OS=Oryza sativa subsp. japon... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02001A04SK IF1 Citrus clementina cDNA clone C02001A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288489 ID=CX288489|Name=CX288489|organism=Citrus clementina|type=EST|length=434bp
CATATCGGTCAGGCCGGTATCCAGGTCGGAAATGCCTGCTGGGAACTCTA
CTGCCTCGAGCACGGCATTCAGCCTGATGGCCAAATGCCAAGTGATAAGA
CAGTCGGAGGTGGCGACGATGCTTTCAACACCTTTTTCAGTGAAACAGGT
GCAGGGAAGCACGTGCCTCGTGCTGTCTTTGTTGATCTTGAGCCCACTGT
CATTGATGAAGTGAGGACCGGAACTTACCGCCAGCTCTTCCACCCTGAGC
AGCTCATCAGTGGCAAGGAAGACGCTGCCAACAACTTCGCCCGTGGCCAC
TATACCATTGGTAAGGAGATTGTTGATCTCTGCCTTGACCGCATCAGGAA
GCTGGCTGATAACTGCACTGGTCTCCAGGGATTCCTTGTTTTCAATGCTG
TTGGTGGAGGAACTGGCTCTGGTCTTGGGTCTCT
back to top