CX288491

Overview
NameCX288491
Unique NameCX288491
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length539
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig619 contig Ccv1_Contig619:24..562. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX288491 vs. ExPASy Swiss-Prot
Match: IPYR1_ARATH (Soluble inorganic pyrophosphatase 1, chloroplastic OS=Arabidopsis thaliana GN=PPA1 PE=1 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 8.541e-64
Identity = 116/162 (71.60%), Postives = 128/162 (79.01%), Query Frame = 2
Query:   62 ISQTTSCLLSKTPFALKHKSH---ITNLCFGTKGVAFPSKRLFSCRAIYNPQVQITEECQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRYYPYNINWNYGLFPQTWEDPSFANSEVEGAFGDN 538
            ++QTTSC L+K  F L  K        LCF  + +   SKR FSC AIYNPQV++ EE   E+LDYRVFF++ SGKKVSPWHDIPL LGDGVFNF+VEIPKES AKMEVATDE +TPIKQD KKGKLRYYPYNINWNYGL PQTWEDPS ANSEVEG FGDN
Sbjct:   13 VTQTTSCFLAKQAFTLPAKKSCGGFGGLCFSRRALVLKSKRPFSCSAIYNPQVKVQEEGPAESLDYRVFFLDGSGKKVSPWHDIPLTLGDGVFNFIVEIPKESKAKMEVATDEDFTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPSHANSEVEGCFGDN 174          
BLAST of CX288491 vs. ExPASy Swiss-Prot
Match: IPYR1_CHLRE (Soluble inorganic pyrophosphatase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ppa1 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.203e-33
Identity = 66/108 (61.11%), Postives = 84/108 (77.78%), Query Frame = 2
Query:  215 ITEECQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRYYPYNINWNYGLFPQTWEDPSFANSEVEGAFGDN 538
            + E+   ++L+YR+FF     K+VS WH+IPL  GDG  +++ EIPKE+SAKMEVATDE  TPIKQD+KKGKLR+YPYNINWNYG+ PQTWEDP   ++ + GA GDN
Sbjct:   48 VEEKGPKDSLEYRMFF-KQGAKEVSCWHEIPLYAGDGHLHYICEIPKETSAKMEVATDEPRTPIKQDVKKGKLRFYPYNINWNYGMLPQTWEDPGHTDATL-GAAGDN 153          
BLAST of CX288491 vs. ExPASy Swiss-Prot
Match: IPYR_BOVIN (Inorganic pyrophosphatase OS=Bos taurus GN=PPA1 PE=1 SV=2)

HSP 1 Score: 117.087 bits (292), Expect = 5.412e-26
Identity = 59/111 (53.15%), Postives = 73/111 (65.77%), Query Frame = 2
Query:  221 EECQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPY-NINWNYGLFPQTWEDPSFANSEVEGAFGDN 538
            E   P TL+YRVF  N  G+ +SP+HDIP+     VF+ VVE+P+ S+AKME+AT +   PIKQD+KKGKLRY    +PY    WNYG  PQTWEDP   N +  G  GDN
Sbjct:    8 ERAAPFTLEYRVFLKNEKGQYISPFHDIPIYADKEVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGH-NDKHTGCCGDN 117          
BLAST of CX288491 vs. ExPASy Swiss-Prot
Match: IPYR_MOUSE (Inorganic pyrophosphatase OS=Mus musculus GN=Ppa1 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 7.068e-26
Identity = 57/111 (51.35%), Postives = 73/111 (65.77%), Query Frame = 2
Query:  221 EECQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPY-NINWNYGLFPQTWEDPSFANSEVEGAFGDN 538
            E   P TL+YRVF  N  G+ +SP+HD+P+     VF+ VVE+P+ S+AKME+AT +   PIKQD+KKGKLRY    +PY    WNYG  PQTWEDP  ++    G  GDN
Sbjct:    8 ERAAPFTLEYRVFLKNEKGQYISPFHDVPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHSDKHT-GCCGDN 117          
BLAST of CX288491 vs. ExPASy Swiss-Prot
Match: IPYR_MACFA (Inorganic pyrophosphatase OS=Macaca fascicularis GN=PPA1 PE=2 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 1.206e-25
Identity = 58/111 (52.25%), Postives = 73/111 (65.77%), Query Frame = 2
Query:  221 EECQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPY-NINWNYGLFPQTWEDPSFANSEVEGAFGDN 538
            E   P +L+YRVF  N  G+ +SP+HDIP+     VF+ VVE+P+ S+AKME+AT +   PIKQD+KKGKLRY    +PY    WNYG  PQTWEDP   N +  G  GDN
Sbjct:    8 ERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGH-NDKHTGCCGDN 117          
BLAST of CX288491 vs. ExPASy Swiss-Prot
Match: IPYR_HUMAN (Inorganic pyrophosphatase OS=Homo sapiens GN=PPA1 PE=1 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 1.206e-25
Identity = 58/111 (52.25%), Postives = 73/111 (65.77%), Query Frame = 2
Query:  221 EECQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPY-NINWNYGLFPQTWEDPSFANSEVEGAFGDN 538
            E   P +L+YRVF  N  G+ +SP+HDIP+     VF+ VVE+P+ S+AKME+AT +   PIKQD+KKGKLRY    +PY    WNYG  PQTWEDP   N +  G  GDN
Sbjct:    8 ERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGH-NDKHTGCCGDN 117          
BLAST of CX288491 vs. ExPASy Swiss-Prot
Match: IPYR_PONAB (Inorganic pyrophosphatase OS=Pongo abelii GN=PPA1 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.021e-24
Identity = 57/111 (51.35%), Postives = 72/111 (64.86%), Query Frame = 2
Query:  221 EECQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPY-NINWNYGLFPQTWEDPSFANSEVEGAFGDN 538
            E   P +L+YRVF  N  G+ +SP+HDIP+     VF+ VVE+P+ S+AKME+AT +   PIKQD+KK KLRY    +PY    WNYG  PQTWEDP   N +  G  GDN
Sbjct:    8 ERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKRKLRYVANLFPYKGYIWNYGAIPQTWEDPGH-NDKHTGCCGDN 117          
BLAST of CX288491 vs. ExPASy Swiss-Prot
Match: IPYR_ASHGO (Inorganic pyrophosphatase OS=Ashbya gossypii GN=IPP1 PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 4.741e-22
Identity = 57/107 (53.27%), Postives = 75/107 (70.09%), Query Frame = 2
Query:  239 TLDYRVFFVNNSGKKVSPWHDIPLQLGDG--VFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPYN-INWNYGLFPQTWEDPSFANSEVEGAFGDN 538
            TLDYRVF +  +GK VSP+HDIPL   +   +FN VVEIP+ ++AK+E+  +E   PI QD KKGKLRY    +P++    NYG FPQTWEDP+ A+ E + A+GDN
Sbjct:   13 TLDYRVF-IEKAGKVVSPFHDIPLYADEENQIFNMVVEIPRWTNAKLEITKEEAMNPIIQDTKKGKLRYVRNCFPHHGYIHNYGAFPQTWEDPNVAHPETK-AYGDN 117          
BLAST of CX288491 vs. ExPASy Swiss-Prot
Match: IPYR2_MOUSE (Inorganic pyrophosphatase 2, mitochondrial OS=Mus musculus GN=Ppa2 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.379e-21
Identity = 58/130 (44.62%), Postives = 74/130 (56.92%), Query Frame = 2
Query:  218 TEEC-QPETLDYRVFFVNNSGKKVSPWHDIPLQLG-----------------DGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRYYP-----YNINWNYGLFPQTWEDPSFANSEVEGAFGDN 538
            TEE   P + DYR+FF + +G  +SP+HDIPL+                   + +FN VVEIP+ ++AKME+AT+E   PIKQDIK GKLRY P         WNYG  PQTWEDP   +   +   GDN
Sbjct:   32 TEELGHPRSQDYRLFFKHVAGHYISPFHDIPLKADCKEEHDIPRKKARNDEYENLFNMVVEIPRWTNAKMEIATEEPLNPIKQDIKNGKLRYTPNIFPHKGYIWNYGALPQTWEDPHLRDKSTD-CCGDN 160          
BLAST of CX288491 vs. ExPASy Swiss-Prot
Match: IPYR_EMENI (Inorganic pyrophosphatase OS=Emericella nidulans GN=ipp1 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.014e-21
Identity = 54/110 (49.09%), Postives = 73/110 (66.36%), Query Frame = 2
Query:  230 QPETLDYRVFFVNNSGKKVSPWHDIPLQLG--DGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPY-NINWNYGLFPQTWEDPSFANSEVEGAFGDN 538
            QP TL++RV+ +   G+ VSP+HDIPL       V N +VEIP+ ++AK E++ +E   PIKQD KKGKLR+    +P+    WNYG FPQTWEDP+  + E + A GDN
Sbjct:   10 QPYTLEHRVY-IEKDGQPVSPFHDIPLYANAEKTVLNMIVEIPRWTNAKQEISKEEFLNPIKQDTKKGKLRFVRNCFPHKGYLWNYGAFPQTWEDPNVVHPETK-AKGDN 117          
The following BLAST results are available for this feature:
BLAST of CX288491 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 28
Match NameE-valueIdentityDescription
IPYR1_ARATH8.541e-6471.60Soluble inorganic pyrophosphatase 1, chloroplastic... [more]
IPYR1_CHLRE1.203e-3361.11Soluble inorganic pyrophosphatase 1, chloroplastic... [more]
IPYR_BOVIN5.412e-2653.15Inorganic pyrophosphatase OS=Bos taurus GN=PPA1 PE... [more]
IPYR_MOUSE7.068e-2651.35Inorganic pyrophosphatase OS=Mus musculus GN=Ppa1 ... [more]
IPYR_MACFA1.206e-2552.25Inorganic pyrophosphatase OS=Macaca fascicularis G... [more]
IPYR_HUMAN1.206e-2552.25Inorganic pyrophosphatase OS=Homo sapiens GN=PPA1 ... [more]
IPYR_PONAB1.021e-2451.35Inorganic pyrophosphatase OS=Pongo abelii GN=PPA1 ... [more]
IPYR_ASHGO4.741e-2253.27Inorganic pyrophosphatase OS=Ashbya gossypii GN=IP... [more]
IPYR2_MOUSE1.379e-2144.62Inorganic pyrophosphatase 2, mitochondrial OS=Mus ... [more]
IPYR_EMENI4.014e-2149.09Inorganic pyrophosphatase OS=Emericella nidulans G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02001A06SK IF1 Citrus clementina cDNA clone C02001A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288491 ID=CX288491|Name=CX288491|organism=Citrus clementina|type=EST|length=539bp
CACTTTCTCACTCACTCCCACTCACAGTCGCCAGTCAGCAGCCATGGCAG
CCGCAAAAGCGATAAGCCAAACCACTTCTTGCTTGCTGTCCAAAACACCC
TTTGCTCTGAAACACAAATCCCACATCACAAATCTTTGCTTTGGTACCAA
AGGAGTTGCTTTTCCGTCAAAGAGGCTGTTTTCATGTAGGGCTATTTATA
ATCCTCAGGTTCAAATCACAGAGGAGTGCCAGCCTGAAACTCTAGATTAC
AGAGTCTTTTTCGTCAACAATTCTGGCAAAAAGGTTTCTCCCTGGCATGA
CATACCGCTGCAATTGGGTGACGGTGTTTTCAACTTTGTTGTTGAAATAC
CCAAAGAATCAAGTGCAAAGATGGAGGTTGCTACTGATGAGCTATACACC
CCTATTAAACAGGATATAAAGAAGGGGAAGCTTCGATACTACCCATACAA
CATAAATTGGAATTATGGATTGTTTCCACAAACATGGGAAGATCCATCTT
TTGCAAACTCTGAAGTTGAAGGGGCATTTGGGGATAATG
back to top