CX288494

Overview
NameCX288494
Unique NameCX288494
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length561
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14357 contig Ccv1_Contig14357:140..700. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX288494 vs. ExPASy Swiss-Prot
Match: VDAC1_ARATH (Mitochondrial outer membrane protein porin 1 OS=Arabidopsis thaliana GN=At3g01280 PE=1 SV=3)

HSP 1 Score: 190.66 bits (483), Expect = 4.242e-48
Identity = 93/182 (51.10%), Postives = 128/182 (70.33%), Query Frame = 3
Query:    3 LFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEILPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIILGDKGDTIRASYVH 548
            L+ +IGKKA+DLL KD+N+DQK SI+T+S AGVA+TST  KKG L  GDVA Q + KN+  D+KV T+S  L T T+ E  P  ++I S KVPD NSGK+E+QY H++A  ++++ L Q+P ++ +  IG+  +A G +  +DT SGNFTK  AG+S TK D  AS+ + DKGD + ASY H
Sbjct:    7 LYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQSRRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTSMGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASLTVNDKGDLLNASYYH 188          
BLAST of CX288494 vs. ExPASy Swiss-Prot
Match: VDAC_PEA (Outer plastidial membrane protein porin OS=Pisum sativum GN=POR1 PE=1 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 2.750e-47
Identity = 90/185 (48.65%), Postives = 126/185 (68.11%), Query Frame = 3
Query:    3 LFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEILPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIILGDKGDTIRASYVHHLD 557
            L+ DIGKKA+DLL KDY++D+K +ISTYS  GVA+TS+  KKG L  GDV  Q K KN+  D+KVDT SN+ TT T+ E  P  KAI S KVP+  SGK+E+QY H++A  +S++ L  +P ++ ++ IGT ++AFGA+  +DT  G  TK  A ++  K D   S+ L +KGD + ASY H ++
Sbjct:    7 LYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGELFLGDVNTQLKNKNITTDIKVDTNSNLFTTITVNEPAPGVKAILSFKVPEQTSGKVELQYLHEYAGISSSVGLKANPIVNFSSVIGTNALAFGADISFDTKLGELTKSNAAVNFVKDDLIGSLTLNEKGDLLSASYYHAIN 191          
BLAST of CX288494 vs. ExPASy Swiss-Prot
Match: VDAC1_SOLTU (Mitochondrial outer membrane protein porin of 34 kDa OS=Solanum tuberosum PE=1 SV=2)

HSP 1 Score: 185.267 bits (469), Expect = 1.782e-46
Identity = 91/182 (50.00%), Postives = 119/182 (65.38%), Query Frame = 3
Query:    3 LFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEILPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIILGDKGDTIRASYVH 548
            L+ +IGKKA+DLL KDY +D K SI+TYS  GV +TS+  KKG L   DV  Q K KNV  D+KVDT SN+ TT T+ E  P  K I S +VPD  SGKLEVQY HD+A   +++ L  +P ++ +  +GT  IA G +  +DT +G+FTK  AG+S T  D  AS+ L +KGD + ASY H
Sbjct:    7 LYTEIGKKARDLLYKDYQSDHKFSITTYSPTGVVITSSGSKKGDLFLADVNTQLKNKNVTTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGICTSVGLTANPIVNFSGVVGTNIIALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNNKGDNLTASYYH 188          
BLAST of CX288494 vs. ExPASy Swiss-Prot
Match: VDAC2_SOLTU (Mitochondrial outer membrane protein porin of 36 kDa OS=Solanum tuberosum PE=1 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 5.186e-46
Identity = 88/182 (48.35%), Postives = 122/182 (67.03%), Query Frame = 3
Query:    3 LFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEILPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIILGDKGDTIRASYVH 548
            L++DIGKKA+DLL +DY +D K +++TYS  GVA+T++ +KKG L   DV+ Q K KN+  DVKVDT SN+ TT T+ E  P  K I S  VPD  SGK+E+QY H++A   ++I L  SP ++ +   G  ++A G +  +DT +GNFTK  AG+S +  D  AS+ L DKGDT+ ASY H
Sbjct:    7 LYSDIGKKARDLLYRDYVSDHKFTVTTYSTTGVAITASGLKKGELFLADVSTQLKNKNITTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTSIGLTASPLVNFSGVAGNNTVALGTDLSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGDTVSASYYH 188          
BLAST of CX288494 vs. ExPASy Swiss-Prot
Match: VDAC2_ARATH (Mitochondrial outer membrane protein porin 2 OS=Arabidopsis thaliana GN=HSR2 PE=1 SV=3)

HSP 1 Score: 183.726 bits (465), Expect = 5.186e-46
Identity = 86/180 (47.78%), Postives = 118/180 (65.56%), Query Frame = 3
Query:    3 LFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEILPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIILGDKGDTIRASY 542
            L+ +IGKKA+DLL +DY  DQK S++TYS  GVA+T+T   KG L  GDVA Q K  N   DVKV T+S++LTT T  E  P  K I   K+PD+ SGK EVQYFHD+A  ++++    +P ++ +  +GT  ++ G +  Y+T SGNF  + AG + TK D  AS+IL DKG+ + ASY
Sbjct:    7 LYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQVKNNNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTSVGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGEKLNASY 186          
BLAST of CX288494 vs. ExPASy Swiss-Prot
Match: VDAC1_ORYSJ (Mitochondrial outer membrane protein porin OS=Oryza sativa subsp. japonica GN=VDAC1 PE=1 SV=3)

HSP 1 Score: 179.874 bits (455), Expect = 7.488e-45
Identity = 83/182 (45.60%), Postives = 126/182 (69.23%), Query Frame = 3
Query:    3 LFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEILPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIILGDKGDTIRASYVH 548
            L+ +IGKKA+DLL +DY  D K +++TY+  GVA+T+T+ KK  L  G++ +Q K KN+  DVK +++SN++TT T+ E+ P  K+I S  VPD  SGK E+QY HD+A  +++I L  SP +++++  GT ++A GA+   DT +GN TKY AG+S +  D  AS+ L +KGD++ ASY H
Sbjct:    6 LYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNKNITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGLTASPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLNLNNKGDSLTASYYH 187          
BLAST of CX288494 vs. ExPASy Swiss-Prot
Match: VDAC1_WHEAT (Mitochondrial outer membrane porin OS=Triticum aestivum GN=VDAC1 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.322e-41
Identity = 80/183 (43.72%), Postives = 120/183 (65.57%), Query Frame = 3
Query:    3 LFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEIL-PSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIILGDKGDTIRASYVH 548
            L++ IGKKAKDLL +DY  D K +++TY+  G A+T+T+ KK  L+ G++ +Q K KN+  DVK ++ SN++TT T  ++  P  K I S  VPD  SGK+E+QY HD+A   ++I L  +P ++++   GT ++A GA+   DT + NF KY A +S T  D  AS+ L +KGD++ ASY H
Sbjct:    6 LYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGPAITATSTKKADLTVGEIQSQIKNKNITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVELQYLHDYAGINASIGLTANPVVNLSGAFGTSALAVGADVSLDTATKNFAKYNAALSYTNQDLIASLNLNNKGDSLTASYYH 188          
BLAST of CX288494 vs. ExPASy Swiss-Prot
Match: VDAC_MAIZE (Outer plastidial membrane protein porin OS=Zea mays GN=POR1 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.110e-39
Identity = 79/187 (42.25%), Postives = 120/187 (64.17%), Query Frame = 3
Query:    3 LFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEI-LPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIILGDKGDTIRASYVHHLDN 560
            L+ DIGKK +DLL KDYN  QK  ++T S  GVA+T+   +K     G++  Q K K +  DVK ++ES++LTT T+ E   P  K+I +L VPD  SGKLE QY H++A   +++ LN +P ++++   G+ +++ G +  +DT + +FTKY A +S+T PD  AS+ L + GDT+ ASY H + N
Sbjct:    7 LYTDIGKKTRDLLYKDYNTHQKFCLTTSSPNGVAITAAGTRKNESIFGELHTQIKNKKLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTLVASYYHLVKN 193          
The following BLAST results are available for this feature:
BLAST of CX288494 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
VDAC1_ARATH4.242e-4851.10Mitochondrial outer membrane protein porin 1 OS=Ar... [more]
VDAC_PEA2.750e-4748.65Outer plastidial membrane protein porin OS=Pisum s... [more]
VDAC1_SOLTU1.782e-4650.00Mitochondrial outer membrane protein porin of 34 k... [more]
VDAC2_SOLTU5.186e-4648.35Mitochondrial outer membrane protein porin of 36 k... [more]
VDAC2_ARATH5.186e-4647.78Mitochondrial outer membrane protein porin 2 OS=Ar... [more]
VDAC1_ORYSJ7.488e-4545.60Mitochondrial outer membrane protein porin OS=Oryz... [more]
VDAC1_WHEAT1.322e-4143.72Mitochondrial outer membrane porin OS=Triticum aes... [more]
VDAC_MAIZE2.110e-3942.25Outer plastidial membrane protein porin OS=Zea may... [more]
back to top
Properties
Property NameValue
Genbank descriptionC02001A09SK IF1 Citrus clementina cDNA clone C02001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288494 ID=CX288494|Name=CX288494|organism=Citrus clementina|type=EST|length=561bp
GACTCTTCGCCGACATCGGCAAAAAAGCCAAAGATCTTTTGACGAAGGAC
TACAACGCCGATCAGAAAATCAGTATCTCCACTTACAGCGGTGCCGGAGT
GGCTCTCACATCAACTGCTGTGAAAAAGGGAGGACTCTCTGCTGGTGACG
TTGCTGCACAGTACAAGTATAAGAACGTTTTATTCGATGTCAAAGTGGAC
ACAGAGTCGAATATTTTGACAACCTTCACTCTTACTGAGATCCTTCCATC
AACAAAGGCTATTGCTTCCTTGAAAGTGCCTGATTATAACTCTGGCAAGT
TGGAGGTTCAGTACTTCCATGATCATGCCACCTTTACTTCAGCCATTGCT
TTGAATCAATCCCCTTGCATTGATGTTACAGCCACCATTGGTACCCCGAG
CATTGCTTTTGGTGCTGAGGCTGGGTATGATACCACATCTGGTAATTTTA
CAAAGTACACAGCCGGCATTAGTGTGACCAAACCAGATTCATGTGCTTCA
ATAATTCTGGGTGACAAGGGAGACACAATTAGAGCATCATACGTACATCA
TCTGGACAACT
back to top